Detailed information NTG0626776

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: N2A94_RS10485
• Genome accession: NZ_CP104048
• Coordinates: 2007407..2007727 (-)
• Length: 106 a.a.
• NCBI ID: WP_013794397.1
• Uniprot ID: -
• Organism: Streptococcus parauberis strain KSP20
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2002407..2012727

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
N2A94_RS10445 (N2A94_10445)	-	2002769..2003221 (-)	453	WP_003108634.1	hypothetical protein	-
N2A94_RS10450 (N2A94_10450)	-	2003214..2003426 (-)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
N2A94_RS10455 (N2A94_10455)	-	2003537..2004730 (-)	1194	WP_003108638.1	acetate kinase	-
N2A94_RS10460 (N2A94_10460)	comGH	2004786..2005742 (-)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
N2A94_RS10465 (N2A94_10465)	comGG	2005849..2006346 (-)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
N2A94_RS10470 (N2A94_10470)	comGF/cglF	2006324..2006761 (-)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
N2A94_RS10475 (N2A94_10475)	comGE	2006739..2007038 (-)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
N2A94_RS10480 (N2A94_10480)	comGD	2007010..2007453 (-)	444	WP_307877782.1	competence type IV pilus minor pilin ComGD	Machinery gene
N2A94_RS10485 (N2A94_10485)	comGC	2007407..2007727 (-)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
N2A94_RS10490 (N2A94_10490)	-	2008380..2009105 (-)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
N2A94_RS10495 (N2A94_10495)	-	2009098..2009562 (-)	465	WP_013794399.1	phage holin family protein	-
N2A94_RS10500 (N2A94_10500)	-	2009566..2009715 (-)	150	WP_259966511.1	hypothetical protein	-
N2A94_RS10505 (N2A94_10505)	-	2009778..2010116 (-)	339	WP_013794400.1	DUF1366 domain-containing protein	-
N2A94_RS10510 (N2A94_10510)	-	2010165..2012021 (-)	1857	WP_013794401.1	DUF859 family phage minor structural protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11963.03 Da
• Isoelectric Point: 6.9754

>NTDB_id=626776 N2A94_RS10485 WP_013794397.1 2007407..2007727(-) (comGC) [Streptococcus parauberis strain KSP20]
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

• Length: 321 bp

>NTDB_id=626776 N2A94_RS10485 WP_013794397.1 2007407..2007727(-) (comGC) [Streptococcus parauberis strain KSP20]
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus mutans UA140	55.556	93.396	0.519
comGC	Streptococcus mutans UA159	55.556	93.396	0.519
comGC	Streptococcus gordonii str. Challis substr. CH1	53.846	85.849	0.462
comGC/cglC	Streptococcus mitis SK321	55.294	80.189	0.443
comGC	Lactococcus lactis subsp. cremoris KW2	52.222	84.906	0.443
comGC/cglC	Streptococcus pneumoniae D39	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae R6	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae TIGR4	52.941	80.189	0.425
comGC/cglC	Streptococcus mitis NCTC 12261	53.571	79.245	0.425