Detailed information NTG0610234

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: RES5_RS06240
• Genome accession: NZ_CP084235
• Coordinates: 1248561..1248881 (+)
• Length: 106 a.a.
• NCBI ID: WP_011275670.1
• Uniprot ID: -
• Organism: Staphylococcus haemolyticus strain SE2.14
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1243561..1253881

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RES5_RS06210 (RES5_006210)	-	1244348..1244551 (+)	204	WP_037550632.1	YqgQ family protein	-
RES5_RS06215 (RES5_006215)	-	1244548..1245534 (+)	987	WP_037550630.1	ROK family glucokinase	-
RES5_RS06220 (RES5_006220)	-	1245534..1245857 (+)	324	WP_011275666.1	MTH1187 family thiamine-binding protein	-
RES5_RS06225 (RES5_006225)	-	1245859..1246485 (+)	627	WP_037550628.1	MBL fold metallo-hydrolase	-
RES5_RS06230 (RES5_006230)	comGA	1246537..1247511 (+)	975	WP_037550626.1	competence type IV pilus ATPase ComGA	Machinery gene
RES5_RS06235 (RES5_006235)	comGB	1247483..1248547 (+)	1065	WP_161517201.1	competence type IV pilus assembly protein ComGB	-
RES5_RS06240 (RES5_006240)	comGC	1248561..1248881 (+)	321	WP_011275670.1	competence type IV pilus major pilin ComGC	Machinery gene
RES5_RS06245 (RES5_006245)	comGD	1248946..1249314 (+)	369	WP_226955309.1	competence type IV pilus minor pilin ComGD	-
RES5_RS06250 (RES5_006250)	-	1249295..1249594 (+)	300	WP_053024491.1	hypothetical protein	-
RES5_RS11970	-	1249575..1249652 (+)	78	Protein_1205	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
RES5_RS06255 (RES5_006255)	-	1249752..1250003 (+)	252	WP_226955311.1	hypothetical protein	-
RES5_RS06260 (RES5_006260)	-	1250163..1250681 (+)	519	WP_085060036.1	shikimate kinase	-
RES5_RS06265 (RES5_006265)	gcvT	1250870..1251961 (+)	1092	WP_053026662.1	glycine cleavage system aminomethyltransferase GcvT	-
RES5_RS06270 (RES5_006270)	gcvPA	1251978..1253330 (+)	1353	WP_161511599.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11782.84 Da
• Isoelectric Point: 8.5328

>NTDB_id=610234 RES5_RS06240 WP_011275670.1 1248561..1248881(+) (comGC) [Staphylococcus haemolyticus strain SE2.14]
MKNHFENLKKLKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHIQSTGCEAQVKMINSQIEAYTLKHNRTPSNINDLIND
GLIKEGQKQCRSGETITISNGEAIAN

Nucleotide

• Length: 321 bp

>NTDB_id=610234 RES5_RS06240 WP_011275670.1 1248561..1248881(+) (comGC) [Staphylococcus haemolyticus strain SE2.14]
ATGAAAAATCACTTTGAAAATTTAAAAAAATTAAAAGCTTTTACTCTAATAGAAATGTTATTAGTATTACTAATTATCAG
CGTATTACTAATATTAATTATTCCAAACATTGCAAAACAAACAGCACATATCCAGTCCACAGGTTGTGAAGCTCAAGTCA
AAATGATAAATAGTCAAATAGAAGCATATACATTAAAACATAATCGTACACCTTCTAATATAAATGATCTTATCAATGAT
GGCCTTATAAAAGAAGGACAAAAACAATGCAGATCAGGAGAAACTATTACAATATCTAATGGTGAGGCTATTGCGAACTA
G

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-33)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	83.333	96.226	0.802
comGC	Staphylococcus aureus MW2	83.333	96.226	0.802
comYC	Streptococcus gordonii str. Challis substr. CH1	45.192	98.113	0.443
comGC/cglC	Streptococcus mitis SK321	45.745	88.679	0.406
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	88.679	0.396
comGC/cglC	Streptococcus mitis NCTC 12261	49.383	76.415	0.377
comGC/cglC	Streptococcus pneumoniae R6	48.148	76.415	0.368
comGC/cglC	Streptococcus pneumoniae D39	48.148	76.415	0.368
comGC/cglC	Streptococcus pneumoniae Rx1	48.148	76.415	0.368