Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KVP03_RS02555 | Genome accession | NZ_CP077959 |
| Coordinates | 489643..489855 (+) | Length | 70 a.a. |
| NCBI ID | WP_050316270.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain SEZ_14-145 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 451460..498803 | 489643..489855 | within | 0 |
Gene organization within MGE regions
Location: 451460..498803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KVP03_RS02265 (KVP03_02260) | - | 451460..452527 (-) | 1068 | WP_050316299.1 | tyrosine-type recombinase/integrase | - |
| KVP03_RS02270 (KVP03_02265) | - | 452795..453481 (-) | 687 | WP_012678830.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| KVP03_RS02275 (KVP03_02270) | - | 453492..454238 (-) | 747 | WP_012678831.1 | helix-turn-helix domain-containing protein | - |
| KVP03_RS02280 (KVP03_02275) | - | 454402..454617 (+) | 216 | WP_012678832.1 | phage repressor protein | - |
| KVP03_RS02285 (KVP03_02280) | - | 454652..454801 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| KVP03_RS02290 (KVP03_02285) | - | 454798..454998 (-) | 201 | WP_002988329.1 | KTSC domain-containing protein | - |
| KVP03_RS02295 (KVP03_02290) | - | 455109..455393 (+) | 285 | WP_012678833.1 | hypothetical protein | - |
| KVP03_RS02300 (KVP03_02295) | - | 455390..455536 (+) | 147 | WP_012678834.1 | hypothetical protein | - |
| KVP03_RS02305 (KVP03_02300) | - | 455740..455985 (+) | 246 | WP_012678836.1 | helix-turn-helix domain-containing protein | - |
| KVP03_RS02310 (KVP03_02305) | - | 456132..456515 (+) | 384 | WP_012678837.1 | DnaD domain-containing protein | - |
| KVP03_RS02315 (KVP03_02310) | - | 456496..456729 (+) | 234 | WP_012678838.1 | hypothetical protein | - |
| KVP03_RS02320 (KVP03_02315) | - | 456726..456866 (+) | 141 | WP_142240698.1 | hypothetical protein | - |
| KVP03_RS02325 (KVP03_02320) | - | 456875..457081 (+) | 207 | WP_050316298.1 | hypothetical protein | - |
| KVP03_RS02330 (KVP03_02325) | - | 457243..458148 (+) | 906 | WP_050316297.1 | recombinase RecT | - |
| KVP03_RS02335 (KVP03_02330) | - | 458148..459359 (+) | 1212 | WP_050316296.1 | DUF1351 domain-containing protein | - |
| KVP03_RS02340 (KVP03_02335) | - | 459352..460188 (+) | 837 | WP_050316295.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| KVP03_RS02345 (KVP03_02340) | - | 460373..460714 (+) | 342 | WP_050316294.1 | hypothetical protein | - |
| KVP03_RS02350 (KVP03_02345) | - | 460711..461223 (+) | 513 | WP_050316293.1 | hypothetical protein | - |
| KVP03_RS02355 (KVP03_02350) | - | 461210..461404 (+) | 195 | WP_050316292.1 | hypothetical protein | - |
| KVP03_RS02360 (KVP03_02355) | - | 461401..461718 (+) | 318 | WP_050316291.1 | VVA0879 family protein | - |
| KVP03_RS02365 (KVP03_02360) | - | 461697..461897 (+) | 201 | WP_050316289.1 | hypothetical protein | - |
| KVP03_RS02370 (KVP03_02365) | - | 461890..462117 (+) | 228 | WP_050316287.1 | hypothetical protein | - |
| KVP03_RS02375 (KVP03_02370) | - | 462121..462264 (+) | 144 | WP_166525024.1 | hypothetical protein | - |
| KVP03_RS02380 (KVP03_02375) | - | 462261..462842 (+) | 582 | WP_074632266.1 | DUF1642 domain-containing protein | - |
| KVP03_RS10580 | - | 463010..463240 (+) | 231 | WP_050316286.1 | hypothetical protein | - |
| KVP03_RS02385 (KVP03_02380) | - | 463619..464053 (+) | 435 | WP_042356698.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KVP03_RS02390 (KVP03_02385) | - | 464256..465419 (+) | 1164 | WP_050316285.1 | DNA modification methylase | - |
| KVP03_RS02395 (KVP03_02390) | - | 465585..466061 (+) | 477 | WP_050316284.1 | hypothetical protein | - |
| KVP03_RS02400 (KVP03_02395) | - | 466144..467358 (+) | 1215 | WP_050316283.1 | PBSX family phage terminase large subunit | - |
| KVP03_RS02405 (KVP03_02400) | - | 467368..468867 (+) | 1500 | WP_050316281.1 | phage portal protein | - |
| KVP03_RS02410 (KVP03_02405) | - | 468867..470477 (+) | 1611 | WP_050315872.1 | phage minor capsid protein | - |
| KVP03_RS02415 (KVP03_02410) | - | 470443..470664 (+) | 222 | WP_050315871.1 | CPCC family cysteine-rich protein | - |
| KVP03_RS02420 (KVP03_02415) | - | 470716..471000 (+) | 285 | WP_230923174.1 | hypothetical protein | - |
| KVP03_RS02425 (KVP03_02420) | - | 471086..471325 (+) | 240 | WP_050315869.1 | hypothetical protein | - |
| KVP03_RS02430 (KVP03_02425) | - | 471310..471912 (+) | 603 | WP_230923175.1 | hypothetical protein | - |
| KVP03_RS02435 (KVP03_02430) | - | 471914..472786 (+) | 873 | WP_230923176.1 | hypothetical protein | - |
| KVP03_RS02440 (KVP03_02435) | - | 472797..473045 (+) | 249 | WP_050315866.1 | hypothetical protein | - |
| KVP03_RS02445 (KVP03_02440) | - | 473048..473434 (+) | 387 | WP_050315865.1 | hypothetical protein | - |
| KVP03_RS02450 (KVP03_02445) | - | 473428..473772 (+) | 345 | WP_050315864.1 | putative minor capsid protein | - |
| KVP03_RS02455 (KVP03_02450) | - | 473769..474122 (+) | 354 | WP_050315863.1 | minor capsid protein | - |
| KVP03_RS02460 (KVP03_02455) | - | 474125..474493 (+) | 369 | WP_050315862.1 | hypothetical protein | - |
| KVP03_RS02465 (KVP03_02460) | - | 474497..474994 (+) | 498 | WP_050316279.1 | phage tail tube protein | - |
| KVP03_RS02470 (KVP03_02465) | - | 475014..475421 (+) | 408 | WP_050315860.1 | hypothetical protein | - |
| KVP03_RS02475 (KVP03_02470) | - | 475429..476046 (+) | 618 | WP_050316278.1 | Gp15 family bacteriophage protein | - |
| KVP03_RS02480 (KVP03_02475) | - | 476047..478494 (+) | 2448 | WP_050315858.1 | phage tail tape measure protein | - |
| KVP03_RS02485 (KVP03_02480) | - | 478498..479259 (+) | 762 | WP_050315857.1 | phage tail domain-containing protein | - |
| KVP03_RS02490 (KVP03_02485) | - | 479270..481267 (+) | 1998 | WP_230923177.1 | phage tail protein | - |
| KVP03_RS10480 (KVP03_02490) | - | 481267..481965 (+) | 699 | WP_269063358.1 | collagen-like protein | - |
| KVP03_RS02500 (KVP03_02495) | - | 481967..482581 (+) | 615 | WP_230923178.1 | hypothetical protein | - |
| KVP03_RS02505 (KVP03_02500) | - | 482720..482899 (+) | 180 | WP_043053058.1 | CopG family transcriptional regulator | - |
| KVP03_RS02510 (KVP03_02505) | - | 483014..483286 (+) | 273 | WP_043053024.1 | hypothetical protein | - |
| KVP03_RS02515 (KVP03_02510) | - | 483349..484107 (+) | 759 | WP_043053025.1 | BRO family protein | - |
| KVP03_RS02520 (KVP03_02515) | - | 484240..486123 (+) | 1884 | WP_230923179.1 | gp58-like family protein | - |
| KVP03_RS02525 (KVP03_02520) | - | 486132..486563 (+) | 432 | WP_050316275.1 | DUF1617 family protein | - |
| KVP03_RS02530 (KVP03_02525) | - | 486567..487178 (+) | 612 | WP_050316274.1 | DUF1366 domain-containing protein | - |
| KVP03_RS02535 (KVP03_02530) | - | 487190..487561 (+) | 372 | WP_012678881.1 | phage holin family protein | - |
| KVP03_RS02540 (KVP03_02535) | - | 487687..488904 (+) | 1218 | WP_230923180.1 | peptidoglycan amidohydrolase family protein | - |
| KVP03_RS02545 (KVP03_02540) | - | 488980..489165 (-) | 186 | WP_050316272.1 | helix-turn-helix domain-containing protein | - |
| KVP03_RS02550 (KVP03_02545) | - | 489192..489470 (-) | 279 | WP_050316271.1 | hypothetical protein | - |
| KVP03_RS02555 (KVP03_02550) | prx | 489643..489855 (+) | 213 | WP_050316270.1 | Paratox | Regulator |
| KVP03_RS02560 (KVP03_02555) | - | 490107..490310 (+) | 204 | WP_012514799.1 | cold-shock protein | - |
| KVP03_RS02565 (KVP03_02560) | - | 490480..490941 (+) | 462 | WP_012677252.1 | CtsR family transcriptional regulator | - |
| KVP03_RS02570 (KVP03_02565) | clpC | 490941..493382 (+) | 2442 | WP_165623668.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
| KVP03_RS10520 | - | 493730..493875 (-) | 146 | Protein_448 | putative holin-like toxin | - |
| KVP03_RS02580 (KVP03_02575) | - | 494156..494587 (+) | 432 | WP_230923181.1 | hypothetical protein | - |
| KVP03_RS02585 (KVP03_02580) | - | 494589..495878 (+) | 1290 | WP_230923182.1 | lipase family protein | - |
| KVP03_RS02590 (KVP03_02585) | - | 495860..496252 (+) | 393 | WP_043052249.1 | hypothetical protein | - |
| KVP03_RS02595 (KVP03_02590) | - | 496233..496523 (+) | 291 | WP_230923183.1 | hypothetical protein | - |
| KVP03_RS02600 (KVP03_02595) | groES | 496823..497110 (+) | 288 | WP_012514806.1 | co-chaperone GroES | - |
| KVP03_RS02605 (KVP03_02600) | groL | 497178..498803 (+) | 1626 | WP_043025047.1 | chaperonin GroEL | - |
Sequence
Protein
Download Length: 70 a.a. Molecular weight: 8183.28 Da Isoelectric Point: 4.5680
>NTDB_id=585645 KVP03_RS02555 WP_050316270.1 489643..489855(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ_14-145]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEEVQPWEVVTEEKVENVLRELDWRSVKSRSKLL
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEEVQPWEVVTEEKVENVLRELDWRSVKSRSKLL
Nucleotide
Download Length: 213 bp
>NTDB_id=585645 KVP03_RS02555 WP_050316270.1 489643..489855(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ_14-145]
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATATTTGATTATGTGCTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACCGAGGAAAAAGTAGAAAATG
TGCTGAGGGAGTTAGATTGGCGGTCGGTCAAAAGTCGGTCAAAGTTACTCTAA
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATATTTGATTATGTGCTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACCGAGGAAAAAGTAGAAAATG
TGCTGAGGGAGTTAGATTGGCGGTCGGTCAAAAGTCGGTCAAAGTTACTCTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
84.286 |
0.714 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
82.857 |
0.671 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
82.857 |
0.643 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
84.286 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
60 |
0.543 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
58.571 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
58.571 |
0.457 |