Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG15_RS00695 Genome accession   NZ_CP094087
Coordinates   151204..151329 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe093     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146204..156329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG15_RS00670 (MPG15_00670) - 146266..148488 (+) 2223 WP_245079487.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG15_RS00675 (MPG15_00675) panD 148478..148828 (+) 351 WP_245079488.1 aspartate 1-decarboxylase -
  MPG15_RS00680 (MPG15_00680) - 148839..149132 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG15_RS00685 (MPG15_00685) - 149132..150127 (+) 996 WP_245079961.1 PDZ domain-containing protein -
  MPG15_RS00690 (MPG15_00690) comB6 150133..151188 (+) 1056 WP_245079489.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG15_RS00695 (MPG15_00695) comB7 151204..151329 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG15_RS00700 (MPG15_00700) comB8 151326..152069 (+) 744 WP_000660529.1 virB8 family protein Machinery gene
  MPG15_RS00705 (MPG15_00705) comB9 152069..153037 (+) 969 WP_245079490.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG15_RS00710 (MPG15_00710) comB10 153030..154166 (+) 1137 WP_245079491.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG15_RS00715 (MPG15_00715) - 154236..155648 (+) 1413 WP_245079492.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=574424 MPG15_RS00695 WP_001217874.1 151204..151329(+) (comB7) [Helicobacter pylori strain Hpfe093]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574424 MPG15_RS00695 WP_001217874.1 151204..151329(+) (comB7) [Helicobacter pylori strain Hpfe093]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAAATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878