Detailed information NTG0553010

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: J7T60_RS08650
• Genome accession: NZ_CP072436
• Coordinates: 1647711..1648139 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24735
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1642711..1653139

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T60_RS08610 (J7T60_08505)	-	1642848..1643141 (-)	294	WP_232085688.1	hypothetical protein	-
J7T60_RS08615	-	1643366..1643791 (-)	426	WP_111679733.1	CPBP family intramembrane glutamic endopeptidase	-
J7T60_RS08620 (J7T60_08515)	-	1644034..1644231 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
J7T60_RS08625 (J7T60_08520)	-	1644480..1645673 (-)	1194	WP_014608740.1	acetate kinase	-
J7T60_RS08630 (J7T60_08525)	comYH	1645729..1646685 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
J7T60_RS08635 (J7T60_08530)	comGG	1646730..1647047 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
J7T60_RS08640 (J7T60_08535)	comYF	1647025..1647462 (-)	438	WP_372433445.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T60_RS08645 (J7T60_08540)	comGE	1647446..1647739 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7T60_RS08650 (J7T60_08545)	comYD	1647711..1648139 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T60_RS08655 (J7T60_08550)	comYC	1648099..1648425 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T60_RS08660 (J7T60_08555)	comYB	1648422..1649522 (-)	1101	WP_372433576.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7T60_RS08665 (J7T60_08560)	comYA	1649404..1650345 (-)	942	WP_180478282.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T60_RS08670 (J7T60_08565)	-	1650426..1650788 (-)	363	WP_372433446.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=553010 J7T60_RS08650 WP_011226626.1 1647711..1648139(-) (comYD) [Streptococcus thermophilus strain S24735]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=553010 J7T60_RS08650 WP_011226626.1 1647711..1648139(-) (comYD) [Streptococcus thermophilus strain S24735]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38