NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	LV497_RS04180	Genome accession	NZ_CP090007
Coordinates	976847..977239 (-)	Length	130 a.a.
NCBI ID	WP_002885697.1	Uniprot ID	-
Organism	Streptococcus salivarius strain SALI-10
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 971847..982239

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LV497_RS04140 (LV497_04140)	dapD	971927..972625 (-)	699	WP_022496726.1	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	-
LV497_RS04145 (LV497_04145)	-	972711..973463 (-)	753	WP_037611112.1	HAD family hydrolase	-
LV497_RS04150 (LV497_04150)	-	973576..974415 (-)	840	WP_037611111.1	putative RNA methyltransferase	-
LV497_RS04160 (LV497_04160)	-	974837..974995 (+)	159	WP_037611110.1	class IIb bacteriocin, lactobin A/cerein 7B family	-
LV497_RS04165 (LV497_04165)	-	975016..975183 (+)	168	WP_037611109.1	class IIb bacteriocin, lactobin A/cerein 7B family	-
LV497_RS04170 (LV497_04170)	-	975231..975482 (+)	252	WP_014635104.1	hypothetical protein	-
LV497_RS04175 (LV497_04175)	tadA	975569..976087 (-)	519	WP_037611108.1	tRNA adenosine(34) deaminase TadA	-
LV497_RS04180 (LV497_04180)	ssbA	976847..977239 (-)	393	WP_002885697.1	single-stranded DNA-binding protein	Machinery gene
LV497_RS04185 (LV497_04185)	-	977668..978345 (-)	678	WP_245085378.1	CPBP family intramembrane glutamic endopeptidase	-
LV497_RS04190 (LV497_04190)	ytpR	978613..979236 (-)	624	WP_245085381.1	YtpR family tRNA-binding protein	-
LV497_RS04195 (LV497_04195)	-	979268..979792 (-)	525	WP_002885713.1	hypothetical protein	-
LV497_RS04200 (LV497_04200)	-	979796..980110 (-)	315	WP_002887006.1	thioredoxin family protein	-
LV497_RS04205 (LV497_04205)	-	980107..980391 (-)	285	WP_070654505.1	DUF4651 domain-containing protein	-
LV497_RS04210 (LV497_04210)	pepA	980491..981558 (+)	1068	WP_201552809.1	glutamyl aminopeptidase	-

Sequence

Protein

Download Length: 130 a.a. Molecular weight: 14759.67 Da Isoelectric Point: 5.9275

                                >NTDB_id=553012 LV497_RS04180 WP_002885697.1 976847..977239(-) (ssbA) [Streptococcus salivarius strain SALI-10]

MYNKVILIGRLTATPEMVKTASDRSFTRVTVAVNRRYKTQNGEREADFITVVVWGRLAETLASYASKGSLISLDGELRTR

KYDKDGQTHYVTEVLCSSFQLLESRAQRAVRENNPDNDLADLVLEEELPF

Nucleotide

Download Length: 393 bp

                                >NTDB_id=553012 LV497_RS04180 WP_002885697.1 976847..977239(-) (ssbA) [Streptococcus salivarius strain SALI-10]

ATGTATAACAAAGTTATTTTAATTGGACGTTTGACGGCGACTCCTGAAATGGTAAAAACTGCTAGTGATAGGTCTTTTAC

ACGTGTCACAGTTGCGGTTAATCGTCGCTATAAGACGCAAAATGGTGAGCGTGAGGCTGACTTTATTACAGTGGTTGTCT

GGGGGCGTTTGGCTGAGACCTTAGCATCTTATGCTAGCAAGGGGAGTTTAATTTCTCTTGATGGGGAGCTTCGTACCCGT

AAGTACGATAAGGATGGTCAAACCCATTACGTTACTGAAGTGCTTTGTTCCTCTTTCCAACTTCTGGAGAGTCGTGCTCA

GCGTGCTGTTAGGGAAAATAATCCTGATAATGACTTGGCTGACCTCGTCTTGGAAGAAGAACTTCCCTTTTAG

Domains

Predicted by InterProScan.

Single-strand binding protein family (SSB)

(3-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	80.916	100	0.815
ssbB/cilA	Streptococcus pneumoniae TIGR4	76.336	100	0.769
ssbB	Streptococcus sobrinus strain NIDR 6715-7	76.336	100	0.769
ssbB/cilA	Streptococcus mitis SK321	75.573	100	0.762
ssbB/cilA	Streptococcus pneumoniae R6	75.573	100	0.762
ssbB/cilA	Streptococcus pneumoniae Rx1	75.573	100	0.762
ssbB/cilA	Streptococcus pneumoniae D39	75.573	100	0.762
ssbB/cilA	Streptococcus mitis NCTC 12261	74.046	100	0.746
ssbB	Lactococcus lactis subsp. cremoris KW2	61.607	86.154	0.531
ssbA	Bacillus subtilis subsp. subtilis str. 168	48.113	81.538	0.392
ssb	Latilactobacillus sakei subsp. sakei 23K	47.17	81.538	0.385

Detailed information NTG0553012