Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI57_RS10070 | Genome accession | NZ_CP071142 |
| Coordinates | 2097297..2097479 (-) | Length | 60 a.a. |
| NCBI ID | WP_012679346.1 | Uniprot ID | C0MBQ2 |
| Organism | Streptococcus equi subsp. equi strain 489_004 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2096710..2154402 | 2097297..2097479 | within | 0 |
Gene organization within MGE regions
Location: 2096710..2154402
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI57_RS10065 (JZI57_10065) | - | 2096710..2097105 (-) | 396 | WP_228275436.1 | DUF5590 domain-containing protein | - |
| JZI57_RS10070 (JZI57_10070) | prx | 2097297..2097479 (-) | 183 | WP_012679346.1 | hypothetical protein | Regulator |
| JZI57_RS11140 | - | 2097547..2097834 (-) | 288 | WP_011106694.1 | hypothetical protein | - |
| JZI57_RS10075 (JZI57_10075) | - | 2097828..2098403 (-) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| JZI57_RS10080 (JZI57_10080) | - | 2098775..2099611 (-) | 837 | WP_012679343.1 | hypothetical protein | - |
| JZI57_RS10085 (JZI57_10085) | - | 2099615..2100157 (-) | 543 | WP_012679342.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| JZI57_RS10090 (JZI57_10090) | - | 2100292..2101488 (-) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| JZI57_RS10095 (JZI57_10095) | - | 2101600..2101779 (-) | 180 | WP_012679339.1 | holin | - |
| JZI57_RS10100 (JZI57_10100) | - | 2101782..2102072 (-) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI57_RS10105 (JZI57_10105) | - | 2102085..2102699 (-) | 615 | WP_012679337.1 | DUF1366 domain-containing protein | - |
| JZI57_RS10110 (JZI57_10110) | - | 2102702..2103133 (-) | 432 | WP_012679336.1 | DUF1617 family protein | - |
| JZI57_RS10115 (JZI57_10115) | - | 2103142..2105025 (-) | 1884 | WP_012679335.1 | gp58-like family protein | - |
| JZI57_RS10120 (JZI57_10120) | - | 2105036..2105653 (-) | 618 | WP_012679334.1 | hypothetical protein | - |
| JZI57_RS10125 (JZI57_10125) | - | 2105655..2106416 (-) | 762 | WP_012679333.1 | collagen-like protein | - |
| JZI57_RS10130 (JZI57_10130) | - | 2106416..2108557 (-) | 2142 | WP_012679332.1 | phage tail spike protein | - |
| JZI57_RS10135 (JZI57_10135) | - | 2108554..2109261 (-) | 708 | WP_012679331.1 | distal tail protein Dit | - |
| JZI57_RS10140 (JZI57_10140) | - | 2109261..2112920 (-) | 3660 | WP_050315849.1 | phage tail tape measure protein | - |
| JZI57_RS10145 (JZI57_10145) | - | 2112933..2113082 (-) | 150 | WP_021299462.1 | hypothetical protein | - |
| JZI57_RS10150 (JZI57_10150) | - | 2113130..2113456 (-) | 327 | WP_012679329.1 | hypothetical protein | - |
| JZI57_RS10155 (JZI57_10155) | - | 2113508..2114098 (-) | 591 | WP_012679328.1 | major tail protein | - |
| JZI57_RS10160 (JZI57_10160) | - | 2114114..2114539 (-) | 426 | WP_050315850.1 | hypothetical protein | - |
| JZI57_RS10165 (JZI57_10165) | - | 2114536..2114913 (-) | 378 | WP_012679326.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JZI57_RS10170 (JZI57_10170) | - | 2114910..2115257 (-) | 348 | WP_012679325.1 | phage head closure protein | - |
| JZI57_RS10175 (JZI57_10175) | - | 2115254..2115556 (-) | 303 | WP_012679324.1 | head-tail connector protein | - |
| JZI57_RS11230 | - | 2115559..2115687 (-) | 129 | WP_012679323.1 | hypothetical protein | - |
| JZI57_RS10180 (JZI57_10180) | - | 2115701..2116888 (-) | 1188 | WP_012679322.1 | phage major capsid protein | - |
| JZI57_RS10185 (JZI57_10185) | - | 2116913..2117578 (-) | 666 | WP_012679321.1 | head maturation protease, ClpP-related | - |
| JZI57_RS10190 (JZI57_10190) | - | 2117556..2118776 (-) | 1221 | WP_012679320.1 | phage portal protein | - |
| JZI57_RS10195 (JZI57_10195) | - | 2118810..2119076 (-) | 267 | WP_012679319.1 | hypothetical protein | - |
| JZI57_RS10200 (JZI57_10200) | - | 2119069..2119239 (-) | 171 | WP_012679318.1 | hypothetical protein | - |
| JZI57_RS10205 (JZI57_10205) | - | 2119236..2120990 (-) | 1755 | WP_012679317.1 | terminase TerL endonuclease subunit | - |
| JZI57_RS10210 (JZI57_10210) | - | 2121005..2121472 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| JZI57_RS10215 (JZI57_10215) | - | 2121635..2121970 (-) | 336 | WP_012679316.1 | HNH endonuclease signature motif containing protein | - |
| JZI57_RS10220 (JZI57_10220) | - | 2122086..2122271 (+) | 186 | WP_012679315.1 | type II toxin-antitoxin system HicA family toxin | - |
| JZI57_RS10225 (JZI57_10225) | - | 2122323..2122700 (+) | 378 | WP_012679314.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| JZI57_RS10230 (JZI57_10230) | - | 2123098..2123538 (-) | 441 | WP_012679312.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JZI57_RS10235 (JZI57_10235) | - | 2123875..2124048 (-) | 174 | WP_012679310.1 | hypothetical protein | - |
| JZI57_RS10240 (JZI57_10240) | - | 2124065..2124364 (-) | 300 | WP_042357412.1 | hypothetical protein | - |
| JZI57_RS10245 (JZI57_10245) | - | 2124391..2124909 (-) | 519 | WP_012679308.1 | DUF1642 domain-containing protein | - |
| JZI57_RS10250 (JZI57_10250) | - | 2124899..2125393 (-) | 495 | WP_162009867.1 | DNA cytosine methyltransferase | - |
| JZI57_RS10255 (JZI57_10255) | - | 2125386..2126177 (-) | 792 | WP_050315852.1 | DNA cytosine methyltransferase | - |
| JZI57_RS10260 (JZI57_10260) | - | 2126179..2126868 (-) | 690 | WP_042356880.1 | site-specific DNA-methyltransferase | - |
| JZI57_RS10265 (JZI57_10265) | - | 2126879..2127106 (-) | 228 | WP_012679306.1 | hypothetical protein | - |
| JZI57_RS10270 (JZI57_10270) | - | 2127099..2127293 (-) | 195 | WP_012679305.1 | hypothetical protein | - |
| JZI57_RS10275 (JZI57_10275) | - | 2127649..2129049 (-) | 1401 | WP_012679304.1 | virulence-associated E family protein | - |
| JZI57_RS10280 (JZI57_10280) | - | 2129033..2129860 (-) | 828 | WP_012679303.1 | bifunctional DNA primase/polymerase | - |
| JZI57_RS10285 (JZI57_10285) | ssbA | 2129874..2130266 (-) | 393 | WP_012679302.1 | single-stranded DNA-binding protein | Machinery gene |
| JZI57_RS10290 (JZI57_10290) | - | 2130267..2130977 (-) | 711 | WP_012679301.1 | ERF family protein | - |
| JZI57_RS10295 (JZI57_10295) | - | 2130987..2132162 (-) | 1176 | WP_050315853.1 | DEAD/DEAH box helicase family protein | - |
| JZI57_RS10300 (JZI57_10300) | - | 2132122..2132595 (-) | 474 | WP_012679299.1 | hypothetical protein | - |
| JZI57_RS10305 (JZI57_10305) | - | 2132592..2133074 (-) | 483 | WP_012679298.1 | siphovirus Gp157 family protein | - |
| JZI57_RS10310 (JZI57_10310) | - | 2133074..2133415 (-) | 342 | WP_012679297.1 | hypothetical protein | - |
| JZI57_RS10315 (JZI57_10315) | - | 2133691..2133942 (-) | 252 | WP_012679294.1 | hypothetical protein | - |
| JZI57_RS10320 (JZI57_10320) | - | 2134015..2134227 (-) | 213 | WP_012679293.1 | hypothetical protein | - |
| JZI57_RS10325 (JZI57_10325) | - | 2134399..2135741 (+) | 1343 | WP_165626751.1 | IS3 family transposase | - |
| JZI57_RS10330 (JZI57_10330) | - | 2136085..2136435 (+) | 351 | WP_012679292.1 | helix-turn-helix transcriptional regulator | - |
| JZI57_RS10335 (JZI57_10335) | - | 2136449..2136853 (+) | 405 | WP_012679291.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JZI57_RS11145 | - | 2137178..2137435 (+) | 258 | WP_012679290.1 | phage membrane protein | - |
| JZI57_RS10345 (JZI57_10345) | - | 2137613..2138779 (+) | 1167 | WP_012679289.1 | site-specific integrase | - |
| JZI57_RS10350 (JZI57_10350) | - | 2138953..2141424 (-) | 2472 | WP_012679288.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| JZI57_RS10355 (JZI57_10355) | - | 2141761..2142402 (+) | 642 | WP_012679287.1 | MBL fold metallo-hydrolase | - |
| JZI57_RS10360 (JZI57_10360) | ftsX | 2142792..2143721 (-) | 930 | WP_042357406.1 | permease-like cell division protein FtsX | - |
| JZI57_RS10365 (JZI57_10365) | ftsE | 2143714..2144406 (-) | 693 | WP_012678167.1 | cell division ATP-binding protein FtsE | - |
| JZI57_RS10375 (JZI57_10375) | - | 2145941..2147503 (-) | 1563 | WP_042356875.1 | ABC transporter ATP-binding protein | - |
| JZI57_RS10380 (JZI57_10380) | - | 2147513..2148103 (-) | 591 | WP_042356873.1 | ABC transporter ATP-binding protein | - |
| JZI57_RS10385 (JZI57_10385) | - | 2148166..2149508 (+) | 1343 | WP_165626751.1 | IS3 family transposase | - |
| JZI57_RS10390 (JZI57_10390) | - | 2149544..2149678 (-) | 135 | Protein_2014 | YccF domain-containing protein | - |
| JZI57_RS10395 (JZI57_10395) | - | 2149675..2150154 (-) | 480 | WP_012679276.1 | aminoacyl-tRNA deacylase | - |
| JZI57_RS10400 (JZI57_10400) | thiT | 2150315..2150878 (-) | 564 | WP_012679277.1 | energy-coupled thiamine transporter ThiT | - |
| JZI57_RS10405 (JZI57_10405) | - | 2151430..2152278 (-) | 849 | WP_012515348.1 | glycoside hydrolase family 25 protein | - |
| JZI57_RS10410 (JZI57_10410) | - | 2152495..2153010 (+) | 516 | WP_012679278.1 | hypothetical protein | - |
| JZI57_RS11150 | - | 2153209..2154036 (-) | 828 | WP_250881511.1 | MFS transporter | - |
| JZI57_RS10420 (JZI57_10420) | - | 2154118..2154402 (-) | 285 | WP_173476790.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6943.77 Da Isoelectric Point: 4.1677
>NTDB_id=543078 JZI57_RS10070 WP_012679346.1 2097297..2097479(-) (prx) [Streptococcus equi subsp. equi strain 489_004]
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVRNGEVVTDEKVEEVMRELDK
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVRNGEVVTDEKVEEVMRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=543078 JZI57_RS10070 WP_012679346.1 2097297..2097479(-) (prx) [Streptococcus equi subsp. equi strain 489_004]
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTAAGGAACGGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTAAGGAACGGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |