Detailed information
Overview
| Name | covR | Type | Regulator |
| Locus tag | LLUC047_RS08870 | Genome accession | NZ_CP068658 |
| Coordinates | 1715492..1716184 (-) | Length | 230 a.a. |
| NCBI ID | WP_011676631.1 | Uniprot ID | A0A0M2ZTN8 |
| Organism | Lactococcus cremoris strain UC047 | ||
| Function | repress the expression of comX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1707105..1753907 | 1715492..1716184 | within | 0 |
Gene organization within MGE regions
Location: 1707105..1753907
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC047_RS08840 (LLUC047_08610) | - | 1708153..1709319 (-) | 1167 | WP_021215735.1 | cell division protein FtsQ/DivIB | - |
| LLUC047_RS08845 (LLUC047_08615) | murG | 1709320..1710393 (-) | 1074 | WP_021215736.1 | undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | - |
| LLUC047_RS08850 (LLUC047_08620) | murD | 1710636..1711985 (-) | 1350 | WP_021211936.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| LLUC047_RS08855 (LLUC047_08625) | - | 1712154..1712495 (-) | 342 | WP_011676628.1 | P-II family nitrogen regulator | - |
| LLUC047_RS08860 (LLUC047_08630) | - | 1712580..1713821 (-) | 1242 | WP_021211937.1 | ammonium transporter | - |
| LLUC047_RS08865 (LLUC047_08635) | covS | 1714007..1715479 (-) | 1473 | WP_021215737.1 | HAMP domain-containing histidine kinase | Regulator |
| LLUC047_RS08870 (LLUC047_08640) | covR | 1715492..1716184 (-) | 693 | WP_011676631.1 | response regulator transcription factor | Regulator |
| LLUC047_RS08875 (LLUC047_08645) | - | 1716340..1716870 (-) | 531 | WP_205536385.1 | DUF177 domain-containing protein | - |
| LLUC047_RS08880 (LLUC047_08650) | - | 1717003..1717248 (-) | 246 | WP_011676633.1 | type B 50S ribosomal protein L31 | - |
| LLUC047_RS08885 (LLUC047_08655) | - | 1717572..1717934 (-) | 363 | Protein_1728 | TIGR02328 family protein | - |
| LLUC047_RS08890 (LLUC047_08660) | - | 1718171..1719082 (-) | 912 | Protein_1729 | CHAP domain-containing protein | - |
| LLUC047_RS08895 (LLUC047_08665) | - | 1719175..1720032 (-) | 858 | WP_301004838.1 | metallophosphoesterase | - |
| LLUC047_RS08900 (LLUC047_08670) | istA | 1720100..1721323 (+) | 1224 | WP_003331415.1 | IS21-like element IS712 family transposase | - |
| LLUC047_RS08905 (LLUC047_08675) | istB | 1721335..1722093 (+) | 759 | WP_003331414.1 | IS21-like element IS712 family helper ATPase IstB | - |
| LLUC047_RS08910 (LLUC047_08680) | - | 1722182..1722382 (-) | 201 | Protein_1733 | hypothetical protein | - |
| LLUC047_RS08915 (LLUC047_08685) | - | 1722486..1722728 (-) | 243 | WP_021215742.1 | hypothetical protein | - |
| LLUC047_RS08920 (LLUC047_08690) | - | 1722730..1722930 (-) | 201 | WP_003132896.1 | helix-turn-helix transcriptional regulator | - |
| LLUC047_RS08925 (LLUC047_08695) | - | 1723097..1723324 (+) | 228 | WP_057720732.1 | DUF2188 domain-containing protein | - |
| LLUC047_RS08930 (LLUC047_08700) | - | 1723291..1723464 (-) | 174 | WP_205536386.1 | hypothetical protein | - |
| LLUC047_RS08935 (LLUC047_08705) | - | 1723619..1723957 (-) | 339 | WP_021214422.1 | hypothetical protein | - |
| LLUC047_RS08940 (LLUC047_08710) | - | 1723971..1724693 (-) | 723 | WP_205536387.1 | ORF6N domain-containing protein | - |
| LLUC047_RS08945 (LLUC047_08715) | - | 1724708..1724938 (-) | 231 | WP_205536388.1 | hypothetical protein | - |
| LLUC047_RS08950 (LLUC047_08720) | - | 1725228..1725575 (+) | 348 | WP_031288643.1 | XRE family transcriptional regulator | - |
| LLUC047_RS08955 (LLUC047_08725) | - | 1725604..1726170 (+) | 567 | WP_021215745.1 | hypothetical protein | - |
| LLUC047_RS13710 | - | 1726182..1726379 (+) | 198 | Protein_1743 | hypothetical protein | - |
| LLUC047_RS08960 (LLUC047_14200) | - | 1726431..1727321 (+) | 891 | WP_373466553.1 | SAP domain-containing protein | - |
| LLUC047_RS08965 (LLUC047_08735) | - | 1727435..1728574 (+) | 1140 | WP_021215747.1 | site-specific integrase | - |
| LLUC047_RS08970 (LLUC047_08740) | - | 1728679..1729752 (-) | 1074 | WP_021215748.1 | carbamoyl phosphate synthase small subunit | - |
| LLUC047_RS08975 (LLUC047_08745) | - | 1729840..1730772 (-) | 933 | WP_011676640.1 | aspartate carbamoyltransferase catalytic subunit | - |
| LLUC047_RS08980 (LLUC047_08750) | - | 1731021..1732313 (-) | 1293 | WP_011834850.1 | uracil-xanthine permease family protein | - |
| LLUC047_RS08985 (LLUC047_08755) | pyrR | 1732413..1732934 (-) | 522 | WP_011676642.1 | bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR | - |
| LLUC047_RS08990 (LLUC047_08760) | - | 1733210..1733908 (-) | 699 | WP_015082648.1 | M50 family metallopeptidase | - |
| LLUC047_RS08995 (LLUC047_08765) | - | 1734013..1734312 (+) | 300 | WP_011676644.1 | helix-turn-helix transcriptional regulator | - |
| LLUC047_RS09000 (LLUC047_08770) | - | 1734302..1735219 (+) | 918 | WP_021037569.1 | cation diffusion facilitator family transporter | - |
| LLUC047_RS09005 (LLUC047_08775) | - | 1735457..1736698 (-) | 1242 | WP_021215749.1 | glutamate-5-semialdehyde dehydrogenase | - |
| LLUC047_RS09010 (LLUC047_08780) | proB | 1736809..1737615 (-) | 807 | WP_011834845.1 | glutamate 5-kinase | - |
| LLUC047_RS09015 (LLUC047_08785) | - | 1737787..1739232 (-) | 1446 | WP_134794187.1 | DUF438 domain-containing protein | - |
| LLUC047_RS09020 (LLUC047_08790) | - | 1739229..1739471 (-) | 243 | WP_015082654.1 | DUF1858 domain-containing protein | - |
| LLUC047_RS09025 (LLUC047_08795) | - | 1739587..1739913 (-) | 327 | WP_015082655.1 | AzlD domain-containing protein | - |
| LLUC047_RS09030 (LLUC047_08800) | - | 1739900..1740607 (-) | 708 | WP_021215750.1 | AzlC family ABC transporter permease | - |
| LLUC047_RS09035 (LLUC047_08805) | - | 1740718..1741829 (+) | 1112 | WP_088792927.1 | IS3-like element IS981 family transposase | - |
| LLUC047_RS09040 (LLUC047_08810) | - | 1742060..1742635 (+) | 576 | WP_126354783.1 | NADPH-dependent F420 reductase | - |
| LLUC047_RS09045 (LLUC047_08815) | - | 1742720..1743262 (+) | 543 | WP_021215752.1 | GNAT family N-acetyltransferase | - |
| LLUC047_RS09050 (LLUC047_08820) | ffh | 1743295..1744851 (-) | 1557 | WP_205536390.1 | signal recognition particle protein | - |
| LLUC047_RS09055 (LLUC047_08825) | - | 1744930..1747986 (-) | 3057 | WP_021215754.1 | leucine-rich repeat domain-containing protein | - |
| LLUC047_RS09060 (LLUC047_08830) | - | 1748045..1749748 (-) | 1704 | WP_205536391.1 | ribonuclease J | - |
| LLUC047_RS09065 (LLUC047_08835) | - | 1750098..1750769 (+) | 672 | WP_021215756.1 | MgtC/SapB family protein | - |
| LLUC047_RS09070 (LLUC047_08840) | - | 1750892..1751782 (+) | 891 | WP_301004839.1 | IS982-like element IS982B family transposase | - |
| LLUC047_RS09075 (LLUC047_08845) | dapA | 1751815..1752708 (-) | 894 | WP_011676659.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| LLUC047_RS09080 (LLUC047_08850) | - | 1753037..1753492 (-) | 456 | WP_011676660.1 | NUDIX hydrolase | - |
Sequence
Protein
Download Length: 230 a.a. Molecular weight: 26654.33 Da Isoelectric Point: 5.1273
>NTDB_id=530260 LLUC047_RS08870 WP_011676631.1 1715492..1716184(-) (covR) [Lactococcus cremoris strain UC047]
MASKKILIIEDEKNLARFVSLELEHEGYATEIKDNGRSGLEEATSKDYDLILLDLMLPELDGFEVARRLRKEKDTPIIMM
TARDSTMDRVAGLDIGADDYITKPFAIEELLARVRAFFRREEHGHAVERAENTSFRDLVIDKTNRTVHRGKKVIDLTRRE
YDLLLTLMQNVGDVVTREHLVSQVWGYEEGTETNVVDVYIRYLRNKIDVEGQDSYIQTVRGLGYVMRERK
MASKKILIIEDEKNLARFVSLELEHEGYATEIKDNGRSGLEEATSKDYDLILLDLMLPELDGFEVARRLRKEKDTPIIMM
TARDSTMDRVAGLDIGADDYITKPFAIEELLARVRAFFRREEHGHAVERAENTSFRDLVIDKTNRTVHRGKKVIDLTRRE
YDLLLTLMQNVGDVVTREHLVSQVWGYEEGTETNVVDVYIRYLRNKIDVEGQDSYIQTVRGLGYVMRERK
Nucleotide
Download Length: 693 bp
>NTDB_id=530260 LLUC047_RS08870 WP_011676631.1 1715492..1716184(-) (covR) [Lactococcus cremoris strain UC047]
ATGGCATCAAAGAAAATTTTGATTATTGAGGATGAAAAGAATTTAGCTCGTTTCGTCTCATTAGAATTAGAGCATGAAGG
CTATGCCACTGAGATTAAAGATAACGGACGTTCTGGGCTTGAAGAAGCAACTTCAAAAGATTATGATTTAATCTTGCTTG
ATTTGATGCTTCCTGAACTTGATGGTTTTGAAGTTGCCCGCCGTTTGCGCAAAGAAAAAGATACTCCAATTATTATGATG
ACCGCGCGTGATTCAACAATGGACCGTGTTGCCGGTCTTGATATTGGAGCAGATGATTATATTACTAAGCCTTTTGCGAT
TGAAGAACTTTTGGCTCGTGTTCGTGCATTCTTCCGTCGTGAAGAACATGGTCATGCTGTAGAACGTGCTGAAAACACTT
CTTTTCGTGATCTTGTAATTGACAAAACAAATCGTACCGTTCACCGCGGTAAAAAAGTAATTGATTTGACGCGTCGTGAA
TACGATCTTCTTTTGACGTTGATGCAAAATGTTGGGGATGTTGTCACTCGCGAACATTTAGTTTCACAAGTTTGGGGATA
TGAAGAAGGAACGGAAACAAATGTTGTTGATGTATATATCCGCTATCTTAGAAATAAAATTGATGTTGAAGGACAAGACA
GCTATATTCAAACCGTTCGTGGTTTGGGTTATGTGATGCGTGAACGCAAATAA
ATGGCATCAAAGAAAATTTTGATTATTGAGGATGAAAAGAATTTAGCTCGTTTCGTCTCATTAGAATTAGAGCATGAAGG
CTATGCCACTGAGATTAAAGATAACGGACGTTCTGGGCTTGAAGAAGCAACTTCAAAAGATTATGATTTAATCTTGCTTG
ATTTGATGCTTCCTGAACTTGATGGTTTTGAAGTTGCCCGCCGTTTGCGCAAAGAAAAAGATACTCCAATTATTATGATG
ACCGCGCGTGATTCAACAATGGACCGTGTTGCCGGTCTTGATATTGGAGCAGATGATTATATTACTAAGCCTTTTGCGAT
TGAAGAACTTTTGGCTCGTGTTCGTGCATTCTTCCGTCGTGAAGAACATGGTCATGCTGTAGAACGTGCTGAAAACACTT
CTTTTCGTGATCTTGTAATTGACAAAACAAATCGTACCGTTCACCGCGGTAAAAAAGTAATTGATTTGACGCGTCGTGAA
TACGATCTTCTTTTGACGTTGATGCAAAATGTTGGGGATGTTGTCACTCGCGAACATTTAGTTTCACAAGTTTGGGGATA
TGAAGAAGGAACGGAAACAAATGTTGTTGATGTATATATCCGCTATCTTAGAAATAAAATTGATGTTGAAGGACAAGACA
GCTATATTCAAACCGTTCGTGGTTTGGGTTATGTGATGCGTGAACGCAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| covR | Lactococcus lactis subsp. lactis strain DGCC12653 |
99.565 |
100 |
0.996 |
| covR | Streptococcus salivarius strain HSISS4 |
68.421 |
99.13 |
0.678 |
| vicR | Streptococcus mutans UA159 |
45.887 |
100 |
0.461 |
| micA | Streptococcus pneumoniae Cp1015 |
43.478 |
100 |
0.435 |
| ciaR | Streptococcus mutans UA159 |
37.611 |
98.261 |
0.37 |
| ciaR | Streptococcus pneumoniae Rx1 |
36.726 |
98.261 |
0.361 |
| ciaR | Streptococcus pneumoniae D39 |
36.726 |
98.261 |
0.361 |
| ciaR | Streptococcus pneumoniae R6 |
36.726 |
98.261 |
0.361 |
| ciaR | Streptococcus pneumoniae TIGR4 |
36.726 |
98.261 |
0.361 |