Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | I6H78_RS05390 | Genome accession | NZ_CP066059 |
| Coordinates | 1107621..1107746 (+) | Length | 41 a.a. |
| NCBI ID | WP_008282505.1 | Uniprot ID | A0A139Q4L7 |
| Organism | Streptococcus oralis strain FDAARGOS_1021 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1102621..1112746
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H78_RS05365 (I6H78_05365) | dnaA | 1103084..1104445 (-) | 1362 | WP_000660625.1 | chromosomal replication initiator protein DnaA | - |
| I6H78_RS05370 (I6H78_05370) | spo0J | 1104662..1105420 (-) | 759 | WP_198459028.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| I6H78_RS05375 (I6H78_05375) | htrA | 1105478..1106674 (-) | 1197 | WP_198459029.1 | S1C family serine protease | Regulator |
| I6H78_RS05380 (I6H78_05380) | rlmH | 1106860..1107339 (+) | 480 | WP_198459030.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| I6H78_RS05390 (I6H78_05390) | comC/comC1 | 1107621..1107746 (+) | 126 | WP_008282505.1 | competence-stimulating peptide ComC | Regulator |
| I6H78_RS05395 (I6H78_05395) | comD | 1107767..1109086 (+) | 1320 | WP_000054555.1 | competence system sensor histidine kinase ComD | Regulator |
| I6H78_RS05400 (I6H78_05400) | comE | 1109083..1109835 (+) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| I6H78_RS05415 (I6H78_05415) | - | 1110072..1110614 (-) | 543 | WP_033630549.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4957.73 Da Isoelectric Point: 10.2767
>NTDB_id=516969 I6H78_RS05390 WP_008282505.1 1107621..1107746(+) (comC/comC1) [Streptococcus oralis strain FDAARGOS_1021]
MKNTVKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
MKNTVKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
Nucleotide
Download Length: 126 bp
>NTDB_id=516969 I6H78_RS05390 WP_008282505.1 1107621..1107746(+) (comC/comC1) [Streptococcus oralis strain FDAARGOS_1021]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis SK321 |
68.966 |
70.732 |
0.488 |
| comC/comC2 | Streptococcus pneumoniae A66 |
58.621 |
70.732 |
0.415 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
58.621 |
70.732 |
0.415 |
| comC | Streptococcus mitis NCTC 12261 |
55.556 |
65.854 |
0.366 |
| comC/blpC | Streptococcus mutans UA159 |
44.118 |
82.927 |
0.366 |