NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	IPU21_RS06750	Genome accession	NZ_CP063368
Coordinates	1415818..1416141 (+)	Length	107 a.a.
NCBI ID	WP_212574401.1	Uniprot ID	A0AAQ0IF01
Organism	Staphylococcus delphini strain 245-1
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1410818..1421141

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IPU21_RS06720 (IPU21_06740)	-	1411498..1411701 (+)	204	WP_014613816.1	YqgQ family protein	-
IPU21_RS06725 (IPU21_06745)	-	1411698..1412684 (+)	987	WP_019165227.1	ROK family glucokinase	-
IPU21_RS06730 (IPU21_06750)	-	1412685..1412996 (+)	312	WP_096541463.1	MTH1187 family thiamine-binding protein	-
IPU21_RS06735 (IPU21_06755)	-	1413009..1413638 (+)	630	WP_096541460.1	MBL fold metallo-hydrolase	-
IPU21_RS06740 (IPU21_06760)	comGA	1413795..1414769 (+)	975	WP_096541457.1	competence type IV pilus ATPase ComGA	Machinery gene
IPU21_RS06745 (IPU21_06765)	comGB	1414738..1415805 (+)	1068	WP_212574400.1	competence type IV pilus assembly protein ComGB	-
IPU21_RS06750 (IPU21_06770)	comGC	1415818..1416141 (+)	324	WP_212574401.1	competence type IV pilus major pilin ComGC	Machinery gene
IPU21_RS06755 (IPU21_06775)	comGD	1416119..1416559 (+)	441	WP_212574402.1	competence type IV pilus minor pilin ComGD	-
IPU21_RS06760 (IPU21_06780)	-	1416664..1416864 (+)	201	WP_241520259.1	hypothetical protein	-
IPU21_RS06765 (IPU21_06785)	-	1416770..1417255 (+)	486	WP_142302713.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
IPU21_RS06770 (IPU21_06790)	-	1417419..1417946 (+)	528	WP_212574403.1	shikimate kinase	-
IPU21_RS06775 (IPU21_06795)	gcvT	1418104..1419195 (+)	1092	WP_096605370.1	glycine cleavage system aminomethyltransferase GcvT	-
IPU21_RS06780 (IPU21_06800)	gcvPA	1419208..1420557 (+)	1350	WP_212574404.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 107 a.a. Molecular weight: 12017.14 Da Isoelectric Point: 8.5012

                                >NTDB_id=494807 IPU21_RS06750 WP_212574401.1 1415818..1416141(+) (comGC) [Staphylococcus delphini strain 245-1]

MIQQLKSKFNQKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR

EGYIKESQKTCKSSEDITIRDGEAVAS

Nucleotide

Download Length: 324 bp

                                >NTDB_id=494807 IPU21_RS06750 WP_212574401.1 1415818..1416141(+) (comGC) [Staphylococcus delphini strain 245-1]

ATGATTCAACAACTTAAATCAAAATTTAACCAAAAGAAAGGATTTACTTTAATTGAAATGTTACTTGTGCTGTTAATTAT

TAGTGTGCTATTGATACTCATTATCCCGAATATTGCTAAACAGTCAGATCATATCCAAAAAACCGGCTGTGCTGCACAAT

TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT

GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAAGTGAAGATATCACAATCAGAGATGGCGAAGCAGTTGCGTC

ATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	73.684	88.785	0.654
comGC	Staphylococcus aureus N315	73.684	88.785	0.654
comYC	Streptococcus suis isolate S10	53.947	71.028	0.383
comGC/cglC	Streptococcus mitis SK321	43.478	85.981	0.374
comGC	Bacillus subtilis subsp. subtilis str. 168	43.478	85.981	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	76.636	0.364
comGC/cglC	Streptococcus pneumoniae D39	42.391	85.981	0.364
comGC/cglC	Streptococcus pneumoniae R6	42.391	85.981	0.364
comGC/cglC	Streptococcus pneumoniae TIGR4	42.391	85.981	0.364
comGC/cglC	Streptococcus pneumoniae Rx1	42.391	85.981	0.364

Detailed information NTG0494807