Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X60_RS04975 | Genome accession | NZ_CP060266 |
| Coordinates | 1001135..1001323 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1450 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 993551..1039861 | 1001135..1001323 | within | 0 |
Gene organization within MGE regions
Location: 993551..1039861
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X60_RS04940 (H7X60_04925) | pfkA | 993551..994564 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| H7X60_RS04945 (H7X60_04930) | - | 994644..997754 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| H7X60_RS04950 (H7X60_04935) | - | 997939..998310 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| H7X60_RS04955 (H7X60_04940) | - | 998310..999008 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| H7X60_RS04960 (H7X60_04945) | - | 999018..999803 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| H7X60_RS04965 (H7X60_04950) | - | 999930..1000544 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| H7X60_RS04975 (H7X60_04960) | prx | 1001135..1001323 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| H7X60_RS04980 (H7X60_04965) | speA | 1001543..1002298 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| H7X60_RS04985 (H7X60_04970) | - | 1002420..1003079 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| H7X60_RS04990 (H7X60_04975) | - | 1003079..1003300 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| H7X60_RS04995 (H7X60_04980) | - | 1003310..1004083 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| H7X60_RS05000 (H7X60_04985) | - | 1004094..1004696 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| H7X60_RS05005 (H7X60_04990) | - | 1004708..1005472 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| H7X60_RS05010 (H7X60_04995) | - | 1005474..1005806 (-) | 333 | WP_011285562.1 | phage holin | - |
| H7X60_RS05015 (H7X60_05000) | - | 1005806..1006129 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| H7X60_RS05020 | - | 1006143..1006265 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| H7X60_RS05025 (H7X60_05005) | - | 1006279..1006626 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| H7X60_RS05030 (H7X60_05010) | - | 1006637..1008499 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| H7X60_RS05035 (H7X60_05015) | - | 1008504..1011944 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| H7X60_RS05040 (H7X60_05020) | - | 1011945..1013429 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| H7X60_RS05045 (H7X60_05025) | - | 1013430..1015235 (-) | 1806 | WP_011054802.1 | phage tail protein | - |
| H7X60_RS05050 (H7X60_05030) | - | 1015228..1015686 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| H7X60_RS05055 (H7X60_05035) | - | 1015659..1015976 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| H7X60_RS05060 (H7X60_05040) | - | 1015989..1016495 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| H7X60_RS05065 (H7X60_05045) | - | 1016507..1016917 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| H7X60_RS05070 (H7X60_05050) | - | 1016919..1017314 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| H7X60_RS05075 (H7X60_05055) | - | 1017311..1017622 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| H7X60_RS05080 (H7X60_05060) | - | 1017619..1017963 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| H7X60_RS05085 (H7X60_05065) | - | 1017977..1018270 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| H7X60_RS05090 (H7X60_05070) | - | 1018283..1019173 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| H7X60_RS05095 (H7X60_05075) | - | 1019192..1019761 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| H7X60_RS05100 | - | 1019870..1020004 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| H7X60_RS05105 (H7X60_05080) | - | 1020006..1020275 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| H7X60_RS05110 (H7X60_05085) | - | 1020282..1021190 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| H7X60_RS05115 (H7X60_05090) | - | 1021159..1022484 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| H7X60_RS05120 (H7X60_05095) | - | 1022484..1023758 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| H7X60_RS05125 (H7X60_05100) | - | 1023748..1024128 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| H7X60_RS05130 (H7X60_05105) | - | 1024738..1025172 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| H7X60_RS05135 (H7X60_05110) | - | 1025458..1025724 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| H7X60_RS05140 (H7X60_05115) | - | 1025721..1026245 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| H7X60_RS05145 (H7X60_05120) | - | 1026248..1026880 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| H7X60_RS05150 (H7X60_05125) | - | 1026882..1027166 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| H7X60_RS05155 (H7X60_05130) | - | 1027163..1027333 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| H7X60_RS05160 (H7X60_05135) | - | 1027330..1027566 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| H7X60_RS09180 | - | 1027566..1027811 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| H7X60_RS05165 (H7X60_05140) | - | 1027808..1028164 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| H7X60_RS05170 (H7X60_05145) | - | 1028161..1028601 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| H7X60_RS05175 (H7X60_05150) | - | 1028601..1028804 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| H7X60_RS05180 (H7X60_05155) | ssb | 1028810..1029235 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| H7X60_RS05185 (H7X60_05160) | - | 1029228..1029902 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| H7X60_RS05190 (H7X60_05165) | - | 1029903..1030385 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| H7X60_RS05195 (H7X60_05170) | - | 1030407..1030661 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| H7X60_RS05200 (H7X60_05175) | - | 1030642..1030995 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| H7X60_RS05205 (H7X60_05180) | - | 1031136..1031918 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| H7X60_RS05210 (H7X60_05185) | - | 1031905..1032735 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| H7X60_RS05215 | - | 1032749..1032937 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| H7X60_RS05220 | - | 1033171..1033410 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| H7X60_RS05225 (H7X60_05195) | - | 1033541..1033750 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| H7X60_RS05230 (H7X60_05200) | - | 1033860..1034060 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| H7X60_RS05235 (H7X60_05205) | - | 1034134..1034520 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| H7X60_RS05240 (H7X60_05210) | - | 1034509..1034718 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| H7X60_RS05245 (H7X60_05215) | - | 1034772..1035371 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| H7X60_RS05250 (H7X60_05220) | - | 1035401..1035559 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| H7X60_RS05255 (H7X60_05225) | - | 1035916..1036740 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| H7X60_RS05260 (H7X60_05230) | - | 1036776..1037669 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| H7X60_RS05265 (H7X60_05235) | - | 1037790..1038878 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| H7X60_RS05270 (H7X60_05240) | - | 1039241..1039861 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=474832 H7X60_RS04975 WP_011285559.1 1001135..1001323(-) (prx) [Streptococcus pyogenes strain SP1450]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=474832 H7X60_RS04975 WP_011285559.1 1001135..1001323(-) (prx) [Streptococcus pyogenes strain SP1450]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |