Detailed information NTG0464533

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLI11_RS11420
• Genome accession: NZ_CP069223
• Coordinates: 2230441..2230710 (-)
• Length: 89 a.a.
• NCBI ID: WP_003129998.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain I.1.1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2225441..2235710

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLI11_RS11380 (LLI11_11320)	-	2225697..2226434 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
LLI11_RS11385 (LLI11_11325)	-	2226611..2227453 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
LLI11_RS11390 (LLI11_11330)	-	2227450..2227887 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LLI11_RS11395 (LLI11_11335)	-	2228094..2229041 (+)	948	WP_003130410.1	IS30 family transposase	-
LLI11_RS11400 (LLI11_11340)	comGG	2229015..2229341 (-)	327	WP_058221568.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLI11_RS11405 (LLI11_11345)	comGF	2229391..2229819 (-)	429	Protein_2221	competence type IV pilus minor pilin ComGF	-
LLI11_RS11410 (LLI11_11350)	comGE	2229782..2230078 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLI11_RS11415 (LLI11_11355)	comGD	2230050..2230481 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLI11_RS11420 (LLI11_11360)	comGC	2230441..2230710 (-)	270	WP_003129998.1	competence type IV pilus major pilin ComGC	Machinery gene
LLI11_RS11425 (LLI11_11365)	-	2230837..2231529 (-)	693	WP_152994386.1	hypothetical protein	-
LLI11_RS11430 (LLI11_11370)	-	2231771..2232550 (-)	780	WP_082225220.1	peptidoglycan amidohydrolase family protein	-
LLI11_RS11435 (LLI11_11375)	-	2232550..2232849 (-)	300	WP_031559226.1	phage holin	-
LLI11_RS11440 (LLI11_11380)	-	2232862..2233212 (-)	351	WP_014570798.1	hypothetical protein	-
LLI11_RS11445 (LLI11_11385)	-	2233225..2233461 (-)	237	WP_082225257.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10123.56 Da
• Isoelectric Point: 4.2950

>NTDB_id=464533 LLI11_RS11420 WP_003129998.1 2230441..2230710(-) (comGC) [Lactococcus lactis subsp. lactis strain I.1.1]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=464533 LLI11_RS11420 WP_003129998.1 2230441..2230710(-) (comGC) [Lactococcus lactis subsp. lactis strain I.1.1]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	86.667	84.27	0.73
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus gordonii str. Challis substr. CH1	56.471	95.506	0.539
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	53.947	85.393	0.461
comGC	Streptococcus mutans UA140	50.685	82.022	0.416
comGC	Streptococcus mutans UA159	50.685	82.022	0.416
comGC/cglC	Streptococcus mitis NCTC 12261	56.25	71.91	0.404