Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HPB53_RS07140 | Genome accession | NZ_CP053571 |
| Coordinates | 1511911..1512372 (+) | Length | 153 a.a. |
| NCBI ID | WP_171785848.1 | Uniprot ID | - |
| Organism | Lactiplantibacillus plantarum strain CNEI-KCA4 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1502815..1542858 | 1511911..1512372 | within | 0 |
Gene organization within MGE regions
Location: 1502815..1542858
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HPB53_RS07045 (HPB53_07050) | - | 1502815..1503951 (-) | 1137 | WP_171785837.1 | site-specific integrase | - |
| HPB53_RS07055 (HPB53_07060) | - | 1504192..1504506 (-) | 315 | WP_033613717.1 | hypothetical protein | - |
| HPB53_RS07060 (HPB53_07065) | - | 1504499..1504912 (-) | 414 | WP_033613719.1 | hypothetical protein | - |
| HPB53_RS07070 (HPB53_07075) | - | 1505092..1505286 (-) | 195 | WP_128536997.1 | hypothetical protein | - |
| HPB53_RS07080 (HPB53_07085) | - | 1505608..1506849 (-) | 1242 | WP_171785838.1 | exonuclease domain-containing protein | - |
| HPB53_RS07085 (HPB53_07090) | - | 1506910..1507299 (-) | 390 | WP_003641360.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HPB53_RS07090 (HPB53_07095) | - | 1507330..1507656 (-) | 327 | WP_171785839.1 | helix-turn-helix domain-containing protein | - |
| HPB53_RS07095 (HPB53_07100) | - | 1507914..1508129 (+) | 216 | WP_171785840.1 | hypothetical protein | - |
| HPB53_RS07100 (HPB53_07105) | - | 1508212..1508949 (+) | 738 | WP_171785841.1 | ORF6N domain-containing protein | - |
| HPB53_RS07105 (HPB53_07110) | - | 1509118..1509351 (-) | 234 | WP_171785842.1 | hypothetical protein | - |
| HPB53_RS07110 (HPB53_07115) | - | 1509446..1509775 (+) | 330 | WP_171785843.1 | DUF771 domain-containing protein | - |
| HPB53_RS07115 (HPB53_07120) | - | 1509864..1510103 (+) | 240 | WP_171785844.1 | tagatose-bisphosphate aldolase | - |
| HPB53_RS07120 (HPB53_07125) | - | 1510115..1510279 (+) | 165 | WP_171785845.1 | hypothetical protein | - |
| HPB53_RS07125 (HPB53_07130) | - | 1510282..1510428 (+) | 147 | WP_171785846.1 | hypothetical protein | - |
| HPB53_RS07130 (HPB53_07135) | - | 1510428..1511288 (+) | 861 | WP_072566891.1 | DUF1351 domain-containing protein | - |
| HPB53_RS07135 (HPB53_07140) | - | 1511288..1511914 (+) | 627 | WP_171785847.1 | ERF family protein | - |
| HPB53_RS07140 (HPB53_07145) | ssb | 1511911..1512372 (+) | 462 | WP_171785848.1 | single-stranded DNA-binding protein | Machinery gene |
| HPB53_RS07145 (HPB53_07150) | - | 1512387..1513079 (+) | 693 | WP_171785849.1 | putative HNHc nuclease | - |
| HPB53_RS07150 (HPB53_07155) | - | 1513121..1513957 (+) | 837 | WP_171785850.1 | helix-turn-helix domain-containing protein | - |
| HPB53_RS07155 (HPB53_07160) | - | 1513961..1514263 (+) | 303 | WP_171785851.1 | hypothetical protein | - |
| HPB53_RS07160 (HPB53_07165) | - | 1514266..1514577 (+) | 312 | WP_171785852.1 | hypothetical protein | - |
| HPB53_RS07165 (HPB53_07170) | - | 1514581..1514739 (+) | 159 | WP_171785853.1 | hypothetical protein | - |
| HPB53_RS07175 (HPB53_07180) | - | 1514796..1515188 (+) | 393 | WP_171785854.1 | YopX family protein | - |
| HPB53_RS07180 (HPB53_07185) | - | 1515547..1515972 (+) | 426 | WP_171785855.1 | transcriptional regulator | - |
| HPB53_RS07185 (HPB53_07190) | - | 1516400..1517017 (+) | 618 | WP_122036804.1 | DUF4145 domain-containing protein | - |
| HPB53_RS07190 (HPB53_07195) | - | 1517089..1517292 (+) | 204 | WP_122036803.1 | hypothetical protein | - |
| HPB53_RS07195 (HPB53_07200) | - | 1517339..1517518 (+) | 180 | WP_122036802.1 | hypothetical protein | - |
| HPB53_RS07200 (HPB53_07205) | - | 1517487..1517999 (+) | 513 | WP_122036801.1 | HNH endonuclease | - |
| HPB53_RS07205 (HPB53_07210) | - | 1518220..1518681 (+) | 462 | WP_033608389.1 | phage terminase small subunit P27 family | - |
| HPB53_RS07210 (HPB53_07215) | - | 1518662..1520575 (+) | 1914 | WP_262351053.1 | terminase TerL endonuclease subunit | - |
| HPB53_RS07215 (HPB53_07220) | - | 1520565..1520759 (+) | 195 | WP_033608390.1 | DUF1056 family protein | - |
| HPB53_RS07220 (HPB53_07225) | - | 1520762..1521958 (+) | 1197 | WP_033608391.1 | phage portal protein | - |
| HPB53_RS07225 (HPB53_07230) | - | 1521936..1522709 (+) | 774 | WP_171785856.1 | head maturation protease, ClpP-related | - |
| HPB53_RS07230 (HPB53_07235) | - | 1522709..1523941 (+) | 1233 | WP_114619779.1 | phage major capsid protein | - |
| HPB53_RS07235 (HPB53_07240) | - | 1524014..1524352 (+) | 339 | WP_016058329.1 | head-tail connector protein | - |
| HPB53_RS07240 (HPB53_07245) | - | 1524336..1524698 (+) | 363 | WP_021732004.1 | phage head closure protein | - |
| HPB53_RS07245 (HPB53_07250) | - | 1524688..1525128 (+) | 441 | WP_021732003.1 | hypothetical protein | - |
| HPB53_RS07250 (HPB53_07255) | - | 1525125..1525508 (+) | 384 | WP_022638398.1 | DUF806 family protein | - |
| HPB53_RS07255 (HPB53_07260) | - | 1525509..1526147 (+) | 639 | WP_021732001.1 | phage tail protein | - |
| HPB53_RS07260 (HPB53_07265) | - | 1526348..1526731 (+) | 384 | WP_016058334.1 | hypothetical protein | - |
| HPB53_RS07265 (HPB53_07270) | - | 1526728..1526919 (+) | 192 | WP_016058335.1 | hypothetical protein | - |
| HPB53_RS07270 (HPB53_07275) | - | 1526932..1531866 (+) | 4935 | WP_171785857.1 | phage tail tip lysozyme | - |
| HPB53_RS07275 (HPB53_07280) | - | 1532007..1533716 (+) | 1710 | WP_316242703.1 | phage tail domain-containing protein | - |
| HPB53_RS07280 (HPB53_07285) | - | 1533782..1536196 (+) | 2415 | WP_171785859.1 | phage tail spike protein | - |
| HPB53_RS07285 (HPB53_07290) | - | 1536213..1538435 (+) | 2223 | WP_171785860.1 | phage tail protein | - |
| HPB53_RS07290 (HPB53_07295) | - | 1538428..1538679 (+) | 252 | WP_171785861.1 | hypothetical protein | - |
| HPB53_RS07295 (HPB53_07300) | - | 1538683..1538844 (+) | 162 | WP_171785862.1 | hypothetical protein | - |
| HPB53_RS16025 | - | 1538828..1541524 (+) | 2697 | WP_262351055.1 | SGNH/GDSL hydrolase family protein | - |
| HPB53_RS07305 (HPB53_07310) | - | 1541576..1542586 (+) | 1011 | Protein_1431 | GH25 family lysozyme | - |
| HPB53_RS07310 (HPB53_07315) | - | 1542595..1542858 (+) | 264 | WP_003644510.1 | hemolysin XhlA family protein | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 17277.73 Da Isoelectric Point: 6.2148
>NTDB_id=445188 HPB53_RS07140 WP_171785848.1 1511911..1512372(+) (ssb) [Lactiplantibacillus plantarum strain CNEI-KCA4]
MINRSVLVGRLTRDPELRYTNGGAAVATFTIAVNRQFTNQNGEREADFINCVIWRKAAENFTNFTHKGSLIGIDGHIQTR
NYENQQGTHIYVTEVVVDNFSLLESRAESEHHQSANSNCHSSNNSNNRKYDNNQNQYGNNGGQIDITDNDLPF
MINRSVLVGRLTRDPELRYTNGGAAVATFTIAVNRQFTNQNGEREADFINCVIWRKAAENFTNFTHKGSLIGIDGHIQTR
NYENQQGTHIYVTEVVVDNFSLLESRAESEHHQSANSNCHSSNNSNNRKYDNNQNQYGNNGGQIDITDNDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=445188 HPB53_RS07140 WP_171785848.1 1511911..1512372(+) (ssb) [Lactiplantibacillus plantarum strain CNEI-KCA4]
ATGATCAACCGAAGCGTTTTAGTTGGTAGGCTTACAAGAGACCCAGAATTACGTTATACGAATGGCGGTGCTGCGGTTGC
AACGTTCACGATTGCTGTAAATCGACAATTTACAAATCAGAACGGAGAACGTGAAGCTGATTTTATTAACTGCGTCATCT
GGCGGAAGGCTGCTGAAAATTTCACTAATTTCACACATAAAGGATCACTTATTGGAATTGATGGTCACATTCAAACGAGA
AACTATGAAAATCAGCAGGGAACTCATATTTACGTTACTGAAGTAGTCGTTGATAACTTCTCATTGCTTGAATCACGTGC
TGAATCTGAACATCATCAAAGTGCTAATAGTAATTGCCACAGCTCAAACAATAGCAATAATAGAAAATATGATAACAATC
AAAACCAGTATGGAAATAATGGCGGCCAGATTGATATCACGGACAATGACTTGCCGTTTTAA
ATGATCAACCGAAGCGTTTTAGTTGGTAGGCTTACAAGAGACCCAGAATTACGTTATACGAATGGCGGTGCTGCGGTTGC
AACGTTCACGATTGCTGTAAATCGACAATTTACAAATCAGAACGGAGAACGTGAAGCTGATTTTATTAACTGCGTCATCT
GGCGGAAGGCTGCTGAAAATTTCACTAATTTCACACATAAAGGATCACTTATTGGAATTGATGGTCACATTCAAACGAGA
AACTATGAAAATCAGCAGGGAACTCATATTTACGTTACTGAAGTAGTCGTTGATAACTTCTCATTGCTTGAATCACGTGC
TGAATCTGAACATCATCAAAGTGCTAATAGTAATTGCCACAGCTCAAACAATAGCAATAATAGAAAATATGATAACAATC
AAAACCAGTATGGAAATAATGGCGGCCAGATTGATATCACGGACAATGACTTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
62.353 |
100 |
0.693 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.595 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
69.281 |
0.386 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
53.704 |
70.588 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
53.704 |
70.588 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
52.778 |
70.588 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
52.778 |
70.588 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
52.778 |
70.588 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
52.778 |
70.588 |
0.373 |