Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | HBA50_RS00040 | Genome accession | NZ_CP050133 |
| Coordinates | 6103..6228 (+) | Length | 41 a.a. |
| NCBI ID | WP_045499896.1 | Uniprot ID | A0A0F2CJ34 |
| Organism | Streptococcus cristatus ATCC 51100 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1103..11228
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HBA50_RS00015 (HBA50_00015) | dnaA | 1557..2912 (-) | 1356 | WP_045499883.1 | chromosomal replication initiator protein DnaA | - |
| HBA50_RS00020 (HBA50_00020) | spo0J | 3125..3886 (-) | 762 | WP_045499887.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| HBA50_RS00025 (HBA50_00025) | htrA | 3949..5127 (-) | 1179 | WP_045499890.1 | S1C family serine protease | Regulator |
| HBA50_RS00030 (HBA50_00030) | rlmH | 5330..5809 (+) | 480 | WP_045499893.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| HBA50_RS00040 (HBA50_00040) | comC | 6103..6228 (+) | 126 | WP_045499896.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | Regulator |
| HBA50_RS00045 (HBA50_00045) | comD/comD2 | 6251..7576 (+) | 1326 | WP_045499899.1 | GHKL domain-containing protein | Regulator |
| HBA50_RS00050 (HBA50_00050) | comE/comE2 | 7573..8316 (+) | 744 | WP_045499902.1 | competence system response regulator transcription factor ComE | Regulator |
| HBA50_RS00065 (HBA50_00065) | - | 8683..10077 (+) | 1395 | WP_166492625.1 | IS1182 family transposase | - |
| HBA50_RS00070 (HBA50_00070) | sdaAA | 10172..11044 (-) | 873 | WP_045499908.1 | L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4762.68 Da Isoelectric Point: 10.9123
>NTDB_id=430181 HBA50_RS00040 WP_045499896.1 6103..6228(+) (comC) [Streptococcus cristatus ATCC 51100]
MKNTQKNFKTIAQFPALNEKELKEVLGGDFRKIGLPRIIFK
MKNTQKNFKTIAQFPALNEKELKEVLGGDFRKIGLPRIIFK
Nucleotide
Download Length: 126 bp
>NTDB_id=430181 HBA50_RS00040 WP_045499896.1 6103..6228(+) (comC) [Streptococcus cristatus ATCC 51100]
ATGAAAAATACTCAGAAAAACTTTAAAACAATCGCTCAATTCCCAGCCTTGAATGAAAAAGAACTTAAAGAAGTTCTTGG
AGGAGATTTTAGAAAGATAGGCCTTCCTCGAATTATTTTTAAGTAA
ATGAAAAATACTCAGAAAAACTTTAAAACAATCGCTCAATTCCCAGCCTTGAATGAAAAAGAACTTAAAGAAGTTCTTGG
AGGAGATTTTAGAAAGATAGGCCTTCCTCGAATTATTTTTAAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus sinensis strain Forsyth1A |
56.41 |
95.122 |
0.537 |
| comC | Streptococcus mitis SK321 |
50 |
97.561 |
0.488 |
| comC/comC2 | Streptococcus pneumoniae A66 |
45 |
97.561 |
0.439 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
45 |
97.561 |
0.439 |
| comC/comC1 | Streptococcus pneumoniae R6 |
48.387 |
75.61 |
0.366 |
| comC/comC1 | Streptococcus pneumoniae G54 |
48.387 |
75.61 |
0.366 |
| comC/comC1 | Streptococcus pneumoniae D39 |
48.387 |
75.61 |
0.366 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
48.387 |
75.61 |
0.366 |