Detailed information    

experimental Experimentally validated

Overview

Name   comC   Type   Regulator
Locus tag   FOA32_RS07420 Genome accession   NZ_JABTYC020000010
Coordinates   55179..55313 (-) Length   44 a.a.
NCBI ID   WP_148881652.1    Uniprot ID   -
Organism   Streptococcus sinensis strain Forsyth1A     
Function   binding to ComD; induce autophosphorylation of ComD   
Competence regulation

Function

The addition of exogenous CSP aided in competence development and successful transformation, yielding an average transformation efficiency comparable to that of other Mitis group streptococci. Additional studies are needed to further delineate the effects of CSP exposure on biofilm formation and virulence.


Genomic Context

Location: 50179..60313
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOA32_RS07390 - 50332..51594 (-) 1263 Protein_47 IS3 family transposase -
  FOA32_RS07405 - 52031..52954 (+) 924 Protein_48 IS481 family transposase -
  FOA32_RS07410 (FOA32_001480) comE 53050..53796 (-) 747 Protein_49 competence system response regulator transcription factor ComE -
  FOA32_RS07415 (FOA32_001481) comD/comD1 53793..55139 (-) 1347 WP_217473256.1 ATP-binding protein Regulator
  FOA32_RS07420 (FOA32_001482) comC 55179..55313 (-) 135 WP_148881652.1 bacteriocin Regulator
  FOA32_RS07430 (FOA32_001483) rlmH 55611..56090 (-) 480 WP_037615060.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  FOA32_RS07435 (FOA32_001484) htrA 56294..57472 (+) 1179 WP_037615063.1 S1C family serine protease Regulator
  FOA32_RS07440 (FOA32_001485) spo0J 57536..58297 (+) 762 WP_217473257.1 ParB/RepB/Spo0J family partition protein Regulator
  FOA32_RS07445 (FOA32_001486) dnaA 58510..59865 (+) 1356 WP_037615069.1 chromosomal replication initiator protein DnaA -

Sequence

Protein


Download         Length: 44 a.a.        Molecular weight: 5110.95 Da        Isoelectric Point: 10.7918

>NTDB_id=578 FOA32_RS07420 WP_148881652.1 55179..55313(-) (comC) [Streptococcus sinensis strain Forsyth1A]
MKKTQENFKALTQFTDLNEKELKKVIGGDSRRLNFGGFIKFFGK

Nucleotide


Download         Length: 135 bp        

>NTDB_id=578 FOA32_RS07420 WP_148881652.1 55179..55313(-) (comC) [Streptococcus sinensis strain Forsyth1A]
ATGAAAAAAACTCAAGAAAACTTCAAAGCGCTGACTCAATTTACAGATTTAAATGAGAAAGAACTAAAAAAAGTTATTGG
AGGAGATAGCAGACGCTTAAATTTTGGAGGTTTCATTAAATTTTTTGGTAAATAA

CSP

This gene is known to encode the precursor of competence stimulating peptide (CSP), which involves in competence development. The mature CSP sequence is displayed as below:

DSRRLNFGGFIKFFGK


Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Alec A Brennan et al. (2022) Investigating the Streptococcus sinensis competence regulon through a combination of transcriptome analysis and phenotypic evaluation. Microbiology (Reading, England) 168(10):001256. [PMID: 36282148]