Detailed information NTG0422577

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: G3T51_RS07855
• Genome accession: NZ_CP048732
• Coordinates: 1580715..1581032 (+)
• Length: 105 a.a.
• NCBI ID: WP_152291612.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain NWAF26
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1575715..1586032

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
G3T51_RS07815	-	1575861..1576052 (+)	192	WP_078099923.1	YqgQ family protein	-
G3T51_RS07820	-	1576049..1577020 (+)	972	WP_048539719.1	ROK family glucokinase	-
G3T51_RS07825	-	1577020..1577334 (+)	315	WP_185160422.1	MTH1187 family thiamine-binding protein	-
G3T51_RS07830	-	1577363..1577602 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
G3T51_RS07835	-	1577700..1578332 (+)	633	WP_075577989.1	MBL fold metallo-hydrolase	-
G3T51_RS07840	-	1578367..1578615 (-)	249	WP_025904960.1	DUF2626 family protein	-
G3T51_RS07845	comGA	1578769..1579608 (+)	840	WP_260440326.1	competence type IV pilus ATPase ComGA	Machinery gene
G3T51_RS07850	comGB	1579660..1580700 (+)	1041	WP_107602469.1	competence type IV pilus assembly protein ComGB	-
G3T51_RS07855	comGC	1580715..1581032 (+)	318	WP_152291612.1	competence type IV pilus major pilin ComGC	Machinery gene
G3T51_RS07860	comGD	1581010..1581459 (+)	450	WP_048539818.1	competence type IV pilus minor pilin ComGD	-
G3T51_RS07865	comGE	1581443..1581724 (+)	282	WP_048539723.1	competence type IV pilus minor pilin ComGE	-
G3T51_RS07870	-	1581738..1582133 (+)	396	WP_242453055.1	competence type IV pilus minor pilin ComGF	-
G3T51_RS07875	-	1582368..1582856 (+)	489	WP_048539725.1	shikimate kinase	-
G3T51_RS07880	gcvT	1583049..1584137 (+)	1089	WP_152292031.1	glycine cleavage system aminomethyltransferase GcvT	-
G3T51_RS07885	gcvPA	1584149..1585492 (+)	1344	WP_152291614.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11563.63 Da
• Isoelectric Point: 8.5013

>NTDB_id=422577 G3T51_RS07855 WP_152291612.1 1580715..1581032(+) (comGC) [Mammaliicoccus sciuri strain NWAF26]
MKKFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLVSDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=422577 G3T51_RS07855 WP_152291612.1 1580715..1581032(+) (comGC) [Mammaliicoccus sciuri strain NWAF26]
ATGAAAAAATTTAAATTTTTAAGTAAAAAAGAAGGATTTACATTGGTTGAGATGCTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAATATAAGTAAGCAATCAGAGACTGTAAAAAGTACTGGATGCCAAGCTCAAGTGAAAA
TGGTTGCTGGTCAAGTAGAAGCTTATACATTGAAGCACGACGCTAAACCAAATTCTATAAATGATTTAGTAAGTGATGGT
TATATTAATCAAAAGCAACTGACATGTAAATCAGGTGAGACAATTACACTTGAAAATGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comYC	Streptococcus mutans UA140	50.575	82.857	0.419
comYC	Streptococcus mutans UA159	50.575	82.857	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus gordonii str. Challis substr. CH1	50	81.905	0.41
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362