Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | GOM48_RS09720 | Genome accession | NZ_CP046523 |
| Coordinates | 1935541..1935663 (-) | Length | 40 a.a. |
| NCBI ID | WP_235097589.1 | Uniprot ID | - |
| Organism | Streptococcus oralis strain SOD | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1930541..1940663
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GOM48_RS09695 (GOM48_09630) | - | 1932678..1933220 (+) | 543 | WP_235097583.1 | TetR/AcrR family transcriptional regulator | - |
| GOM48_RS09710 (GOM48_09645) | comE | 1933460..1934212 (-) | 753 | WP_235097585.1 | competence system response regulator transcription factor ComE | Regulator |
| GOM48_RS09715 (GOM48_09650) | comD | 1934209..1935528 (-) | 1320 | WP_235097586.1 | competence system sensor histidine kinase ComD | Regulator |
| GOM48_RS09720 (GOM48_09655) | comC | 1935541..1935663 (-) | 123 | WP_235097589.1 | competence-stimulating peptide ComC | Regulator |
| GOM48_RS09730 (GOM48_09665) | rlmH | 1935946..1936425 (-) | 480 | WP_235097591.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| GOM48_RS09735 (GOM48_09670) | htrA | 1936610..1937800 (+) | 1191 | WP_235097593.1 | S1C family serine protease | Regulator |
| GOM48_RS09740 (GOM48_09675) | spo0J | 1937858..1938616 (+) | 759 | WP_235097595.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4981.83 Da Isoelectric Point: 10.4095
>NTDB_id=404954 GOM48_RS09720 WP_235097589.1 1935541..1935663(-) (comC) [Streptococcus oralis strain SOD]
MKNTVKLEQFKKLTEKELQEIQGGEIRKENNFLFYFFKRK
MKNTVKLEQFKKLTEKELQEIQGGEIRKENNFLFYFFKRK
Nucleotide
Download Length: 123 bp
>NTDB_id=404954 GOM48_RS09720 WP_235097589.1 1935541..1935663(-) (comC) [Streptococcus oralis strain SOD]
ATGAAAAACACAGTTAAATTGGAACAGTTCAAAAAGCTTACAGAGAAAGAATTGCAGGAGATTCAAGGTGGAGAAATTAG
AAAGGAAAATAATTTTTTATTTTATTTTTTTAAAAGAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTCAAAAAGCTTACAGAGAAAGAATTGCAGGAGATTCAAGGTGGAGAAATTAG
AAAGGAAAATAATTTTTTATTTTATTTTTTTAAAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
62.5 |
100 |
0.625 |
| comC | Streptococcus mitis SK321 |
62.5 |
100 |
0.625 |
| comC/comC2 | Streptococcus pneumoniae A66 |
60 |
100 |
0.6 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
60 |
100 |
0.6 |
| comC/comC1 | Streptococcus pneumoniae R6 |
57.5 |
100 |
0.575 |
| comC/comC1 | Streptococcus pneumoniae G54 |
57.5 |
100 |
0.575 |
| comC/comC1 | Streptococcus pneumoniae D39 |
57.5 |
100 |
0.575 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
57.5 |
100 |
0.575 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
45.946 |
92.5 |
0.425 |