Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   GG619_RS11910 Genome accession   NZ_CP045711
Coordinates   2486757..2487134 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain HN-Q-8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2481757..2492134
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GG619_RS11870 (GG619_11870) - 2482255..2483049 (+) 795 WP_156240427.1 YqhG family protein -
  GG619_RS11875 (GG619_11875) sinI 2483226..2483399 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  GG619_RS11880 (GG619_11880) sinR 2483433..2483768 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GG619_RS11885 (GG619_11885) tasA 2483816..2484601 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  GG619_RS11890 (GG619_11890) sipW 2484666..2485250 (-) 585 WP_015240205.1 signal peptidase I SipW -
  GG619_RS11895 (GG619_11895) tapA 2485222..2485893 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  GG619_RS11900 (GG619_11900) - 2486152..2486481 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  GG619_RS11905 (GG619_11905) - 2486521..2486700 (-) 180 WP_003153093.1 YqzE family protein -
  GG619_RS11910 (GG619_11910) comGG 2486757..2487134 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  GG619_RS11915 (GG619_11915) comGF 2487135..2487635 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  GG619_RS11920 (GG619_11920) comGE 2487544..2487858 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  GG619_RS11925 (GG619_11925) comGD 2487842..2488279 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  GG619_RS11930 (GG619_11930) comGC 2488269..2488577 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  GG619_RS11935 (GG619_11935) comGB 2488582..2489619 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  GG619_RS11940 (GG619_11940) comGA 2489606..2490676 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  GG619_RS11945 (GG619_11945) - 2490869..2491819 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=396231 GG619_RS11910 WP_015417814.1 2486757..2487134(-) (comGG) [Bacillus velezensis strain HN-Q-8]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=396231 GG619_RS11910 WP_015417814.1 2486757..2487134(-) (comGG) [Bacillus velezensis strain HN-Q-8]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment