Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | F0L18_RS06980 | Genome accession | NZ_CP045642 |
| Coordinates | 1289636..1290064 (-) | Length | 142 a.a. |
| NCBI ID | WP_046814053.1 | Uniprot ID | - |
| Organism | Lactobacillus helveticus strain LZ-R-5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1248416..1298209 | 1289636..1290064 | within | 0 |
Gene organization within MGE regions
Location: 1248416..1298209
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F0L18_RS06735 | - | 1248416..1249477 (-) | 1062 | WP_046814087.1 | methionine ABC transporter ATP-binding protein | - |
| F0L18_RS06740 | - | 1249490..1250350 (-) | 861 | WP_046814086.1 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
| F0L18_RS06745 | - | 1250717..1251924 (-) | 1208 | Protein_1321 | HAD-IC family P-type ATPase | - |
| F0L18_RS06750 | - | 1251910..1253040 (+) | 1131 | Protein_1322 | HAD-IC family P-type ATPase | - |
| F0L18_RS06755 | - | 1253137..1253295 (-) | 159 | WP_082990744.1 | xre family toxin-antitoxin system | - |
| F0L18_RS06760 | - | 1253332..1253535 (-) | 204 | WP_080948205.1 | hypothetical protein | - |
| F0L18_RS06765 | - | 1253655..1254173 (-) | 519 | WP_020829131.1 | dihydrofolate reductase | - |
| F0L18_RS06770 | - | 1254192..1255196 (+) | 1005 | WP_153245751.1 | thymidylate synthase | - |
| F0L18_RS06775 | - | 1255287..1255859 (-) | 573 | Protein_1327 | amino acid permease | - |
| F0L18_RS06780 | - | 1256290..1256679 (-) | 390 | WP_046814085.1 | hypothetical protein | - |
| F0L18_RS06785 | - | 1256732..1257181 (-) | 450 | WP_046814084.1 | hypothetical protein | - |
| F0L18_RS06790 | - | 1257184..1257771 (-) | 588 | WP_046814083.1 | hypothetical protein | - |
| F0L18_RS06795 | - | 1258060..1258737 (-) | 678 | WP_228123095.1 | GH25 family lysozyme | - |
| F0L18_RS06800 | - | 1258727..1259146 (-) | 420 | WP_046814082.1 | phage holin | - |
| F0L18_RS06805 | - | 1259136..1259390 (-) | 255 | WP_046814081.1 | hypothetical protein | - |
| F0L18_RS06810 | - | 1259446..1259694 (-) | 249 | WP_046814080.1 | hypothetical protein | - |
| F0L18_RS06815 | - | 1259697..1260296 (-) | 600 | WP_046814079.1 | hypothetical protein | - |
| F0L18_RS06820 | - | 1260333..1261007 (-) | 675 | WP_046814078.1 | hypothetical protein | - |
| F0L18_RS06825 | - | 1261120..1261983 (-) | 864 | WP_046814077.1 | hypothetical protein | - |
| F0L18_RS06830 | - | 1262017..1263600 (-) | 1584 | WP_052747893.1 | hypothetical protein | - |
| F0L18_RS06835 | - | 1263656..1264219 (-) | 564 | WP_228123096.1 | hypothetical protein | - |
| F0L18_RS06840 | - | 1264209..1265390 (-) | 1182 | WP_046814076.1 | baseplate J/gp47 family protein | - |
| F0L18_RS06845 | - | 1265383..1265763 (-) | 381 | WP_046814075.1 | hypothetical protein | - |
| F0L18_RS06850 | - | 1265756..1266235 (-) | 480 | WP_046814074.1 | hypothetical protein | - |
| F0L18_RS06855 | - | 1266248..1267219 (-) | 972 | WP_046814073.1 | hypothetical protein | - |
| F0L18_RS06860 | - | 1267219..1267629 (-) | 411 | WP_046814072.1 | hypothetical protein | - |
| F0L18_RS06865 | - | 1267639..1268670 (-) | 1032 | WP_046814071.1 | LysM domain-containing protein | - |
| F0L18_RS06870 | - | 1268685..1273532 (-) | 4848 | WP_052747892.1 | tape measure protein | - |
| F0L18_RS06875 | - | 1273600..1273851 (-) | 252 | WP_046814070.1 | hypothetical protein | - |
| F0L18_RS06880 | - | 1273802..1274254 (-) | 453 | WP_046814069.1 | hypothetical protein | - |
| F0L18_RS06885 | - | 1274270..1274707 (-) | 438 | WP_046814068.1 | hypothetical protein | - |
| F0L18_RS06890 | - | 1274723..1275850 (-) | 1128 | WP_046814067.1 | DUF3383 family protein | - |
| F0L18_RS06895 | - | 1275850..1276416 (-) | 567 | WP_046814066.1 | hypothetical protein | - |
| F0L18_RS06900 | - | 1276406..1276810 (-) | 405 | WP_046814065.1 | hypothetical protein | - |
| F0L18_RS06905 | - | 1276807..1277439 (-) | 633 | WP_046814064.1 | hypothetical protein | - |
| F0L18_RS06910 | - | 1277439..1277840 (-) | 402 | WP_046814063.1 | hypothetical protein | - |
| F0L18_RS06915 | - | 1277856..1278794 (-) | 939 | WP_046814062.1 | major capsid family protein | - |
| F0L18_RS06920 | - | 1278797..1279360 (-) | 564 | WP_046814061.1 | hypothetical protein | - |
| F0L18_RS06925 | - | 1279372..1280490 (-) | 1119 | WP_046814060.1 | DUF2213 domain-containing protein | - |
| F0L18_RS06930 | - | 1280490..1280858 (-) | 369 | WP_046814059.1 | LysM domain-containing protein | - |
| F0L18_RS06935 | - | 1281424..1282221 (-) | 798 | WP_046814058.1 | phage minor head protein | - |
| F0L18_RS06940 | - | 1282208..1283611 (-) | 1404 | WP_046814057.1 | anti-CBASS protein Acb1 family protein | - |
| F0L18_RS06945 | terL | 1283626..1285098 (-) | 1473 | WP_046814056.1 | phage terminase large subunit | - |
| F0L18_RS06950 | - | 1285085..1285582 (-) | 498 | WP_052747891.1 | hypothetical protein | - |
| F0L18_RS06955 | - | 1285607..1286026 (-) | 420 | WP_052747890.1 | GNAT family N-acetyltransferase | - |
| F0L18_RS06960 | - | 1286023..1286700 (-) | 678 | WP_046814055.1 | ABC transporter ATPase | - |
| F0L18_RS06965 | - | 1286685..1287212 (-) | 528 | WP_046814054.1 | ParB N-terminal domain-containing protein | - |
| F0L18_RS11785 | - | 1287282..1287407 (-) | 126 | WP_265589031.1 | hypothetical protein | - |
| F0L18_RS11790 | - | 1288436..1288564 (-) | 129 | WP_265589032.1 | hypothetical protein | - |
| F0L18_RS06970 | - | 1288598..1289077 (-) | 480 | WP_194269115.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| F0L18_RS06975 | - | 1289289..1289618 (-) | 330 | WP_052747888.1 | helix-turn-helix transcriptional regulator | - |
| F0L18_RS06980 | ssb | 1289636..1290064 (-) | 429 | WP_046814053.1 | single-stranded DNA-binding protein | Machinery gene |
| F0L18_RS06985 | - | 1290261..1290701 (-) | 441 | WP_046814052.1 | hypothetical protein | - |
| F0L18_RS06990 | - | 1290781..1291533 (-) | 753 | WP_046814051.1 | helix-turn-helix domain-containing protein | - |
| F0L18_RS06995 | - | 1291536..1291811 (-) | 276 | WP_228123097.1 | hypothetical protein | - |
| F0L18_RS07000 | - | 1291817..1292674 (-) | 858 | WP_046814049.1 | ERF family protein | - |
| F0L18_RS07005 | - | 1292677..1293555 (-) | 879 | WP_046814048.1 | DUF1351 domain-containing protein | - |
| F0L18_RS07010 | - | 1293548..1293922 (-) | 375 | WP_046814047.1 | hypothetical protein | - |
| F0L18_RS07015 | - | 1294148..1294384 (-) | 237 | WP_046814045.1 | helix-turn-helix transcriptional regulator | - |
| F0L18_RS07020 | - | 1294374..1294619 (-) | 246 | WP_046814044.1 | hypothetical protein | - |
| F0L18_RS07025 | - | 1294616..1294933 (-) | 318 | WP_046814043.1 | helix-turn-helix domain-containing protein | - |
| F0L18_RS07030 | - | 1294943..1295713 (-) | 771 | WP_046814042.1 | phage antirepressor | - |
| F0L18_RS07035 | - | 1295757..1295966 (-) | 210 | WP_046814041.1 | helix-turn-helix transcriptional regulator | - |
| F0L18_RS07040 | - | 1296144..1296515 (+) | 372 | WP_046814599.1 | helix-turn-helix domain-containing protein | - |
| F0L18_RS07045 | - | 1296523..1296963 (+) | 441 | WP_046814040.1 | hypothetical protein | - |
| F0L18_RS07050 | - | 1297103..1298209 (+) | 1107 | WP_046814039.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15691.43 Da Isoelectric Point: 6.3654
>NTDB_id=395770 F0L18_RS06980 WP_046814053.1 1289636..1290064(-) (ssb) [Lactobacillus helveticus strain LZ-R-5]
MINRVVLTGRPTKNLELRSTKSGANVCSFTLAVDRNFKSKNGEREADFISCIAWKKTAEVMSKYVKKGSVIGVDGRIQTR
SYDNRDGQRVYVTEVVVEDFSFLGGADKDSQVSKNNQSSPNQSNDPFDSSEPTGIADDDLPF
MINRVVLTGRPTKNLELRSTKSGANVCSFTLAVDRNFKSKNGEREADFISCIAWKKTAEVMSKYVKKGSVIGVDGRIQTR
SYDNRDGQRVYVTEVVVEDFSFLGGADKDSQVSKNNQSSPNQSNDPFDSSEPTGIADDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=395770 F0L18_RS06980 WP_046814053.1 1289636..1290064(-) (ssb) [Lactobacillus helveticus strain LZ-R-5]
ATGATTAACCGAGTAGTTTTGACAGGCAGACCAACTAAAAATCTTGAGCTTAGAAGTACAAAGTCAGGTGCAAACGTGTG
TTCATTTACGTTGGCTGTTGACAGAAATTTTAAAAGCAAAAATGGAGAACGAGAAGCAGATTTCATCAGCTGTATTGCAT
GGAAAAAGACAGCAGAAGTTATGAGTAAATACGTTAAAAAGGGCTCTGTTATTGGAGTAGACGGAAGAATCCAGACCAGA
AGTTATGACAACCGAGACGGTCAACGGGTTTATGTTACCGAGGTTGTTGTTGAAGACTTTTCATTTTTAGGTGGGGCAGA
TAAAGATAGTCAAGTAAGCAAGAATAATCAATCATCACCAAATCAAAGCAACGATCCGTTTGATTCAAGTGAACCGACAG
GTATTGCAGATGATGATTTACCATTTTAA
ATGATTAACCGAGTAGTTTTGACAGGCAGACCAACTAAAAATCTTGAGCTTAGAAGTACAAAGTCAGGTGCAAACGTGTG
TTCATTTACGTTGGCTGTTGACAGAAATTTTAAAAGCAAAAATGGAGAACGAGAAGCAGATTTCATCAGCTGTATTGCAT
GGAAAAAGACAGCAGAAGTTATGAGTAAATACGTTAAAAAGGGCTCTGTTATTGGAGTAGACGGAAGAATCCAGACCAGA
AGTTATGACAACCGAGACGGTCAACGGGTTTATGTTACCGAGGTTGTTGTTGAAGACTTTTCATTTTTAGGTGGGGCAGA
TAAAGATAGTCAAGTAAGCAAGAATAATCAATCATCACCAAATCAAAGCAACGATCCGTTTGATTCAAGTGAACCGACAG
GTATTGCAGATGATGATTTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.235 |
100 |
0.577 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
44.767 |
100 |
0.542 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.398 |
72.535 |
0.387 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.324 |
100 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.324 |
100 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.62 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.62 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.62 |
100 |
0.366 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.62 |
100 |
0.366 |