Detailed information NTG0392524

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: D5R78_RS06915
• Genome accession: NZ_CP045187
• Coordinates: 1417675..1417995 (+)
• Length: 106 a.a.
• NCBI ID: WP_011275670.1
• Uniprot ID: -
• Organism: Staphylococcus haemolyticus strain VB19458
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1412675..1422995

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D5R78_RS06885 (D5R78_007660)	-	1413462..1413665 (+)	204	WP_011275664.1	YqgQ family protein	-
D5R78_RS06890 (D5R78_007655)	-	1413662..1414648 (+)	987	WP_011275665.1	ROK family glucokinase	-
D5R78_RS06895 (D5R78_007650)	-	1414648..1414971 (+)	324	WP_011275666.1	MTH1187 family thiamine-binding protein	-
D5R78_RS06900 (D5R78_007645)	-	1414973..1415599 (+)	627	WP_011275667.1	MBL fold metallo-hydrolase	-
D5R78_RS06905 (D5R78_007640)	comGA	1415651..1416625 (+)	975	WP_011275668.1	competence type IV pilus ATPase ComGA	Machinery gene
D5R78_RS06910 (D5R78_007635)	comGB	1416597..1417661 (+)	1065	WP_011275669.1	competence type IV pilus assembly protein ComGB	-
D5R78_RS06915 (D5R78_007630)	comGC	1417675..1417995 (+)	321	WP_011275670.1	competence type IV pilus major pilin ComGC	Machinery gene
D5R78_RS06920 (D5R78_007625)	comGD	1417976..1418428 (+)	453	WP_370444504.1	competence type IV pilus minor pilin ComGD	-
D5R78_RS06925 (D5R78_007620)	-	1418409..1418708 (+)	300	WP_011275672.1	hypothetical protein	-
D5R78_RS13905 (D5R78_007615)	-	1418626..1419117 (+)	492	WP_011275673.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
D5R78_RS06930 (D5R78_007605)	-	1419277..1419795 (+)	519	WP_011275674.1	shikimate kinase	-
D5R78_RS06935 (D5R78_007600)	gcvT	1419984..1421075 (+)	1092	WP_033079984.1	glycine cleavage system aminomethyltransferase GcvT	-
D5R78_RS06940 (D5R78_007595)	gcvPA	1421092..1422444 (+)	1353	WP_016931107.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11782.84 Da
• Isoelectric Point: 8.5328

>NTDB_id=392524 D5R78_RS06915 WP_011275670.1 1417675..1417995(+) (comGC) [Staphylococcus haemolyticus strain VB19458]
MKNHFENLKKLKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHIQSTGCEAQVKMINSQIEAYTLKHNRTPSNINDLIND
GLIKEGQKQCRSGETITISNGEAIAN

Nucleotide

• Length: 321 bp

>NTDB_id=392524 D5R78_RS06915 WP_011275670.1 1417675..1417995(+) (comGC) [Staphylococcus haemolyticus strain VB19458]
ATGAAGAATCACTTTGAAAATTTAAAAAAGTTAAAAGCCTTTACTCTAATAGAAATGTTATTAGTATTACTAATTATCAG
CGTATTACTAATATTAATTATTCCAAACATTGCAAAACAAACAGCTCATATCCAGTCCACAGGTTGTGAAGCTCAAGTCA
AAATGATAAATAGTCAAATAGAAGCATATACATTAAAACATAATCGAACACCTTCTAATATAAATGATCTTATAAATGAT
GGCCTTATAAAAGAAGGACAAAAACAATGCAGATCGGGAGAAACAATTACAATATCTAATGGTGAGGCTATTGCGAACTA
G

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-33)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	83.333	96.226	0.802
comGC	Staphylococcus aureus MW2	83.333	96.226	0.802
comYC	Streptococcus gordonii str. Challis substr. CH1	45.192	98.113	0.443
comGC/cglC	Streptococcus mitis SK321	45.745	88.679	0.406
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	88.679	0.396
comGC/cglC	Streptococcus mitis NCTC 12261	49.383	76.415	0.377
comGC/cglC	Streptococcus pneumoniae R6	48.148	76.415	0.368
comGC/cglC	Streptococcus pneumoniae D39	48.148	76.415	0.368
comGC/cglC	Streptococcus pneumoniae Rx1	48.148	76.415	0.368