Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | FOB62_RS06200 | Genome accession | NZ_CP044102 |
| Coordinates | 1206383..1206565 (+) | Length | 60 a.a. |
| NCBI ID | WP_138128179.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae strain FDAARGOS_654 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1163944..1215096 | 1206383..1206565 | within | 0 |
| IS/Tn | 1206798..1208336 | 1206383..1206565 | flank | 233 |
Gene organization within MGE regions
Location: 1163944..1215096
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOB62_RS05890 (FOB62_05890) | - | 1163944..1165017 (-) | 1074 | WP_138128250.1 | site-specific integrase | - |
| FOB62_RS05895 (FOB62_05895) | - | 1165134..1166027 (-) | 894 | WP_000426896.1 | P63C domain-containing protein | - |
| FOB62_RS05900 (FOB62_05900) | - | 1166063..1166896 (-) | 834 | WP_138128248.1 | helix-turn-helix transcriptional regulator | - |
| FOB62_RS11250 | - | 1167251..1167400 (+) | 150 | WP_172601652.1 | hypothetical protein | - |
| FOB62_RS05905 (FOB62_05905) | - | 1167397..1167597 (-) | 201 | WP_138128246.1 | KTSC domain-containing protein | - |
| FOB62_RS05910 (FOB62_05910) | - | 1167655..1167813 (+) | 159 | WP_138128244.1 | hypothetical protein | - |
| FOB62_RS05915 (FOB62_05915) | - | 1167847..1168056 (+) | 210 | WP_138128241.1 | hypothetical protein | - |
| FOB62_RS05920 (FOB62_05920) | - | 1168032..1168724 (-) | 693 | WP_138128239.1 | DUF4145 domain-containing protein | - |
| FOB62_RS05925 (FOB62_05925) | - | 1168777..1168977 (+) | 201 | WP_038433319.1 | helix-turn-helix transcriptional regulator | - |
| FOB62_RS05930 (FOB62_05930) | - | 1169008..1169736 (+) | 729 | WP_138128237.1 | phage antirepressor KilAC domain-containing protein | - |
| FOB62_RS11255 | - | 1169768..1169908 (+) | 141 | WP_003051781.1 | hypothetical protein | - |
| FOB62_RS05935 (FOB62_05935) | - | 1169888..1170262 (-) | 375 | WP_023610946.1 | DUF2513 domain-containing protein | - |
| FOB62_RS11560 | - | 1170313..1170444 (+) | 132 | WP_002984298.1 | hypothetical protein | - |
| FOB62_RS05940 (FOB62_05940) | - | 1170430..1170648 (-) | 219 | WP_032467270.1 | hypothetical protein | - |
| FOB62_RS05945 (FOB62_05945) | - | 1170791..1170976 (+) | 186 | WP_021340658.1 | helix-turn-helix transcriptional regulator | - |
| FOB62_RS05950 (FOB62_05950) | - | 1171034..1171309 (+) | 276 | WP_138128235.1 | DNA-binding protein | - |
| FOB62_RS05955 (FOB62_05955) | - | 1171306..1171491 (+) | 186 | WP_150336231.1 | hypothetical protein | - |
| FOB62_RS05960 (FOB62_05960) | - | 1171585..1171842 (+) | 258 | WP_111679491.1 | transcriptional regulator | - |
| FOB62_RS05965 (FOB62_05965) | - | 1171964..1172374 (+) | 411 | WP_190847655.1 | DnaD domain protein | - |
| FOB62_RS05970 (FOB62_05970) | - | 1172355..1172573 (+) | 219 | WP_136112612.1 | hypothetical protein | - |
| FOB62_RS05975 (FOB62_05975) | - | 1172585..1172725 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| FOB62_RS05980 (FOB62_05980) | - | 1172736..1172990 (+) | 255 | WP_138128229.1 | hypothetical protein | - |
| FOB62_RS11660 (FOB62_05985) | - | 1172993..1173175 (+) | 183 | WP_138128227.1 | hypothetical protein | - |
| FOB62_RS05990 (FOB62_05990) | - | 1173172..1174146 (+) | 975 | WP_138128225.1 | RecT family recombinase | - |
| FOB62_RS05995 (FOB62_05995) | - | 1174143..1174940 (+) | 798 | WP_138128223.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| FOB62_RS11260 | - | 1174950..1175117 (+) | 168 | WP_172601651.1 | hypothetical protein | - |
| FOB62_RS06000 (FOB62_06000) | - | 1175294..1175629 (+) | 336 | WP_138128221.1 | hypothetical protein | - |
| FOB62_RS06005 (FOB62_06005) | - | 1175626..1176138 (+) | 513 | WP_138128219.1 | crossover junction endodeoxyribonuclease RuvC | - |
| FOB62_RS06010 (FOB62_06010) | - | 1176125..1176319 (+) | 195 | WP_138128217.1 | hypothetical protein | - |
| FOB62_RS06015 (FOB62_06015) | - | 1176316..1176705 (+) | 390 | WP_138128215.1 | YopX family protein | - |
| FOB62_RS06020 (FOB62_06020) | - | 1176702..1176878 (+) | 177 | WP_032460883.1 | hypothetical protein | - |
| FOB62_RS06025 (FOB62_06025) | - | 1176878..1177147 (+) | 270 | WP_172601656.1 | hypothetical protein | - |
| FOB62_RS06030 (FOB62_06030) | - | 1177150..1178070 (+) | 921 | WP_138128211.1 | N-6 DNA methylase | - |
| FOB62_RS06035 (FOB62_06035) | - | 1178067..1178294 (+) | 228 | WP_138083799.1 | hypothetical protein | - |
| FOB62_RS06040 (FOB62_06040) | - | 1178296..1178535 (+) | 240 | WP_138083800.1 | hypothetical protein | - |
| FOB62_RS06045 (FOB62_06045) | - | 1178637..1179188 (+) | 552 | WP_138128209.1 | DUF1642 domain-containing protein | - |
| FOB62_RS11265 | - | 1179185..1179355 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| FOB62_RS06050 (FOB62_06050) | - | 1179717..1180154 (+) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| FOB62_RS06060 (FOB62_06060) | - | 1180864..1181340 (+) | 477 | WP_150336232.1 | terminase small subunit | - |
| FOB62_RS06065 (FOB62_06065) | - | 1181343..1182629 (+) | 1287 | WP_281429830.1 | PBSX family phage terminase large subunit | - |
| FOB62_RS06070 (FOB62_06070) | - | 1182643..1184145 (+) | 1503 | WP_111711578.1 | phage portal protein | - |
| FOB62_RS06075 (FOB62_06075) | - | 1184150..1185646 (+) | 1497 | WP_150336233.1 | phage minor capsid protein | - |
| FOB62_RS06080 (FOB62_06080) | - | 1185643..1185870 (+) | 228 | WP_111679809.1 | hypothetical protein | - |
| FOB62_RS06085 (FOB62_06085) | - | 1185944..1186210 (+) | 267 | WP_115283414.1 | hypothetical protein | - |
| FOB62_RS06090 (FOB62_06090) | - | 1186348..1186962 (+) | 615 | WP_111711580.1 | hypothetical protein | - |
| FOB62_RS06095 (FOB62_06095) | - | 1186966..1187784 (+) | 819 | WP_111679812.1 | N4-gp56 family major capsid protein | - |
| FOB62_RS06100 (FOB62_06100) | - | 1187838..1188254 (+) | 417 | WP_111679813.1 | hypothetical protein | - |
| FOB62_RS06105 (FOB62_06105) | - | 1188244..1188576 (+) | 333 | WP_111679814.1 | minor capsid protein | - |
| FOB62_RS06110 (FOB62_06110) | - | 1188576..1188932 (+) | 357 | WP_065361215.1 | minor capsid protein | - |
| FOB62_RS06115 (FOB62_06115) | - | 1188929..1189327 (+) | 399 | WP_138128207.1 | minor capsid protein | - |
| FOB62_RS06120 (FOB62_06120) | - | 1189327..1189791 (+) | 465 | WP_138128205.1 | phage tail protein | - |
| FOB62_RS06125 (FOB62_06125) | - | 1189835..1190269 (+) | 435 | WP_010922086.1 | hypothetical protein | - |
| FOB62_RS06130 (FOB62_06130) | - | 1190273..1190854 (+) | 582 | WP_138128203.1 | bacteriophage Gp15 family protein | - |
| FOB62_RS06135 (FOB62_06135) | - | 1190844..1194104 (+) | 3261 | WP_138128276.1 | tape measure protein | - |
| FOB62_RS06140 (FOB62_06140) | - | 1194101..1194817 (+) | 717 | WP_138128200.1 | distal tail protein Dit | - |
| FOB62_RS06145 (FOB62_06145) | - | 1194814..1196958 (+) | 2145 | WP_138128198.1 | phage tail spike protein | - |
| FOB62_RS06150 (FOB62_06150) | - | 1196955..1198010 (+) | 1056 | WP_138128196.1 | hyaluronoglucosaminidase | - |
| FOB62_RS06155 (FOB62_06155) | - | 1198010..1198645 (+) | 636 | WP_138128194.1 | hypothetical protein | - |
| FOB62_RS06160 (FOB62_06160) | - | 1198656..1200674 (+) | 2019 | WP_138128192.1 | gp58-like family protein | - |
| FOB62_RS06165 (FOB62_06165) | - | 1200687..1201118 (+) | 432 | WP_138128190.1 | DUF1617 family protein | - |
| FOB62_RS06170 (FOB62_06170) | - | 1201121..1201729 (+) | 609 | WP_138128188.1 | hypothetical protein | - |
| FOB62_RS06175 (FOB62_06175) | - | 1201740..1202039 (+) | 300 | WP_023077839.1 | hypothetical protein | - |
| FOB62_RS06180 (FOB62_06180) | - | 1202036..1202221 (+) | 186 | WP_011184796.1 | holin | - |
| FOB62_RS06185 (FOB62_06185) | - | 1202332..1203546 (+) | 1215 | WP_138128186.1 | peptidoglycan amidohydrolase family protein | - |
| FOB62_RS06190 (FOB62_06190) | - | 1203840..1204820 (+) | 981 | WP_138128184.1 | Abi family protein | - |
| FOB62_RS06195 (FOB62_06195) | - | 1204987..1206144 (-) | 1158 | WP_138128182.1 | DNA/RNA non-specific endonuclease | - |
| FOB62_RS06200 (FOB62_06200) | prx | 1206383..1206565 (+) | 183 | WP_138128179.1 | Paratox | Regulator |
| FOB62_RS06205 (FOB62_06205) | - | 1206798..1208290 (+) | 1493 | Protein_1194 | IS1182 family transposase | - |
| FOB62_RS11400 | - | 1208556..1209104 (-) | 549 | WP_003054749.1 | amidohydrolase family protein | - |
| FOB62_RS06215 (FOB62_06215) | - | 1209663..1209866 (+) | 204 | WP_003053018.1 | cold-shock protein | - |
| FOB62_RS06220 (FOB62_06220) | - | 1210062..1210523 (+) | 462 | WP_003054759.1 | CtsR family transcriptional regulator | - |
| FOB62_RS06225 (FOB62_06225) | clpC | 1210523..1212967 (+) | 2445 | WP_003054754.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
| FOB62_RS06230 (FOB62_06230) | groES | 1213145..1213435 (+) | 291 | WP_003054738.1 | co-chaperone GroES | - |
| FOB62_RS06235 (FOB62_06235) | groL | 1213471..1215096 (+) | 1626 | WP_003054752.1 | chaperonin GroEL | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6788.68 Da Isoelectric Point: 3.9286
>NTDB_id=387880 FOB62_RS06200 WP_138128179.1 1206383..1206565(+) (prx) [Streptococcus dysgalactiae strain FDAARGOS_654]
MLTYDEFKQAIDDGYIVGDTVAIVRKDGQIFDYVLPGEPVRLWEVATEEKVEEVLGELGK
MLTYDEFKQAIDDGYIVGDTVAIVRKDGQIFDYVLPGEPVRLWEVATEEKVEEVLGELGK
Nucleotide
Download Length: 183 bp
>NTDB_id=387880 FOB62_RS06200 WP_138128179.1 1206383..1206565(+) (prx) [Streptococcus dysgalactiae strain FDAARGOS_654]
ATGCTAACATACGATGAGTTTAAGCAAGCGATCGATGACGGCTATATCGTAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAGG
TGTTGGGTGAATTAGGCAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCGATCGATGACGGCTATATCGTAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAGG
TGTTGGGTGAATTAGGCAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
92.683 |
68.333 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
68.333 |
0.533 |