Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT51_RS04720 | Genome accession | NZ_CP035448 |
| Coordinates | 889952..890131 (+) | Length | 59 a.a. |
| NCBI ID | WP_136059210.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm70 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 854303..896574 | 889952..890131 | within | 0 |
Gene organization within MGE regions
Location: 854303..896574
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT51_RS04475 (ETT51_04515) | - | 854303..855499 (-) | 1197 | WP_136059220.1 | site-specific integrase | - |
| ETT51_RS04480 (ETT51_04520) | - | 855683..857104 (-) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| ETT51_RS04485 (ETT51_04525) | - | 857119..857505 (-) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT51_RS04490 (ETT51_04530) | - | 857489..857830 (-) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| ETT51_RS04495 (ETT51_04535) | - | 858028..858240 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| ETT51_RS04500 (ETT51_04540) | - | 858268..858987 (+) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT51_RS04505 (ETT51_04545) | - | 859085..859324 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| ETT51_RS04510 (ETT51_04550) | - | 859491..859676 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| ETT51_RS04515 (ETT51_04555) | - | 859747..860004 (+) | 258 | WP_022554795.1 | hypothetical protein | - |
| ETT51_RS04520 (ETT51_04560) | - | 860159..860347 (+) | 189 | WP_029713981.1 | hypothetical protein | - |
| ETT51_RS04525 (ETT51_04565) | dnaB | 860334..861680 (+) | 1347 | WP_136098296.1 | replicative DNA helicase | - |
| ETT51_RS04530 (ETT51_04570) | - | 861667..862413 (+) | 747 | WP_111685852.1 | conserved phage C-terminal domain-containing protein | - |
| ETT51_RS04535 (ETT51_04575) | - | 862414..863235 (+) | 822 | WP_111685853.1 | ATP-binding protein | - |
| ETT51_RS04540 (ETT51_04580) | - | 863235..863465 (+) | 231 | WP_136282147.1 | hypothetical protein | - |
| ETT51_RS04545 | - | 863476..863640 (+) | 165 | WP_153276856.1 | hypothetical protein | - |
| ETT51_RS04550 (ETT51_04585) | - | 863627..864118 (+) | 492 | WP_136059218.1 | MazG-like family protein | - |
| ETT51_RS04555 (ETT51_04590) | - | 864115..864420 (+) | 306 | WP_136026311.1 | DUF1372 family protein | - |
| ETT51_RS04560 (ETT51_04595) | - | 864514..864783 (+) | 270 | WP_231480305.1 | DUF3310 domain-containing protein | - |
| ETT51_RS04565 (ETT51_04600) | - | 864776..865060 (+) | 285 | WP_136059217.1 | hypothetical protein | - |
| ETT51_RS04570 (ETT51_04610) | ssbA | 865305..865697 (+) | 393 | WP_136059216.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT51_RS04575 (ETT51_04615) | - | 865711..865989 (+) | 279 | WP_029713970.1 | hypothetical protein | - |
| ETT51_RS04580 (ETT51_04620) | - | 865986..866324 (+) | 339 | WP_085577390.1 | helix-turn-helix domain-containing protein | - |
| ETT51_RS04585 (ETT51_04625) | - | 866327..866575 (+) | 249 | WP_085577391.1 | hypothetical protein | - |
| ETT51_RS09190 | - | 866760..866909 (+) | 150 | WP_168391464.1 | hypothetical protein | - |
| ETT51_RS04590 (ETT51_04635) | - | 866878..867078 (+) | 201 | WP_085577392.1 | hypothetical protein | - |
| ETT51_RS04595 (ETT51_04640) | - | 867102..867521 (+) | 420 | WP_085577393.1 | DUF1492 domain-containing protein | - |
| ETT51_RS04600 (ETT51_04645) | - | 867616..868179 (+) | 564 | WP_180383159.1 | site-specific integrase | - |
| ETT51_RS04605 (ETT51_04650) | - | 868351..868644 (+) | 294 | WP_002986191.1 | hypothetical protein | - |
| ETT51_RS04610 (ETT51_04655) | - | 868641..868970 (+) | 330 | WP_085577395.1 | HNH endonuclease | - |
| ETT51_RS04615 (ETT51_04660) | - | 869092..869439 (+) | 348 | WP_002986187.1 | hypothetical protein | - |
| ETT51_RS04620 (ETT51_04665) | - | 869420..871078 (+) | 1659 | WP_136059215.1 | terminase TerL endonuclease subunit | - |
| ETT51_RS04625 (ETT51_04670) | - | 871277..872512 (+) | 1236 | WP_003057282.1 | phage portal protein | - |
| ETT51_RS04630 (ETT51_04675) | - | 872516..873232 (+) | 717 | WP_002986180.1 | head maturation protease, ClpP-related | - |
| ETT51_RS04635 (ETT51_04680) | - | 873268..874461 (+) | 1194 | WP_002986177.1 | phage major capsid protein | - |
| ETT51_RS04640 (ETT51_04685) | - | 874476..874763 (+) | 288 | WP_002986176.1 | hypothetical protein | - |
| ETT51_RS04645 (ETT51_04690) | - | 874783..875076 (+) | 294 | WP_136059214.1 | phage gp6-like head-tail connector protein | - |
| ETT51_RS04650 (ETT51_04695) | - | 875078..875455 (+) | 378 | WP_227874190.1 | phage head-tail adapter protein | - |
| ETT51_RS04655 (ETT51_04700) | - | 875427..875798 (+) | 372 | WP_002986170.1 | hypothetical protein | - |
| ETT51_RS04660 (ETT51_04705) | - | 875807..876229 (+) | 423 | WP_002986168.1 | hypothetical protein | - |
| ETT51_RS04665 (ETT51_04710) | - | 876240..876827 (+) | 588 | WP_003057267.1 | hypothetical protein | - |
| ETT51_RS04670 (ETT51_04715) | - | 876848..877219 (+) | 372 | WP_002986164.1 | hypothetical protein | - |
| ETT51_RS09195 | - | 877255..877413 (+) | 159 | WP_002986162.1 | hypothetical protein | - |
| ETT51_RS04675 (ETT51_04720) | - | 877487..880723 (+) | 3237 | WP_085577397.1 | phage tail tape measure protein | - |
| ETT51_RS04680 (ETT51_04725) | - | 880720..881430 (+) | 711 | WP_085577398.1 | phage tail domain-containing protein | - |
| ETT51_RS04685 (ETT51_04730) | - | 881469..883478 (+) | 2010 | WP_197032753.1 | phage tail spike protein | - |
| ETT51_RS04690 (ETT51_04735) | hylP | 883475..884497 (+) | 1023 | WP_020837648.1 | hyaluronidase HylP | - |
| ETT51_RS04695 (ETT51_04740) | - | 884510..886396 (+) | 1887 | WP_111702896.1 | gp58-like family protein | - |
| ETT51_RS04700 (ETT51_04745) | - | 886408..886836 (+) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| ETT51_RS04705 (ETT51_04750) | - | 886839..887465 (+) | 627 | WP_136059212.1 | hypothetical protein | - |
| ETT51_RS04710 (ETT51_04755) | - | 887481..887936 (+) | 456 | WP_002988455.1 | phage holin family protein | - |
| ETT51_RS09440 | - | 887938..888060 (+) | 123 | WP_027968869.1 | hypothetical protein | - |
| ETT51_RS04715 (ETT51_04760) | - | 888048..889256 (+) | 1209 | WP_136059211.1 | glucosaminidase domain-containing protein | - |
| ETT51_RS04720 (ETT51_04765) | prx | 889952..890131 (+) | 180 | WP_136059210.1 | Paratox | Regulator |
| ETT51_RS04725 (ETT51_04770) | - | 890365..890880 (+) | 516 | Protein_878 | elongation factor 4 | - |
| ETT51_RS04730 (ETT51_04775) | slc2 | 891067..892608 (+) | 1542 | WP_156139411.1 | LPXTG-anchored collagen-like adhesin Scl2/SclB | - |
| ETT51_RS04735 (ETT51_04780) | - | 892767..893064 (+) | 298 | Protein_880 | nucleoside-diphosphate kinase | - |
| ETT51_RS04740 (ETT51_04785) | lepA | 893134..894966 (+) | 1833 | WP_010922253.1 | translation elongation factor 4 | - |
| ETT51_RS04745 (ETT51_04790) | slc2 | 895153..896574 (+) | 1422 | WP_156139412.1 | LPXTG-anchored collagen-like adhesin Scl2/SclB | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6746.66 Da Isoelectric Point: 3.9417
>NTDB_id=342135 ETT51_RS04720 WP_136059210.1 889952..890131(+) (prx) [Streptococcus pyogenes strain emm70]
MLTYDEFKQAIDDGYITADAVMIVRKSGQIFDYVLPHEKVKNGEVVTEEVVEEVLVELE
MLTYDEFKQAIDDGYITADAVMIVRKSGQIFDYVLPHEKVKNGEVVTEEVVEEVLVELE
Nucleotide
Download Length: 180 bp
>NTDB_id=342135 ETT51_RS04720 WP_136059210.1 889952..890131(+) (prx) [Streptococcus pyogenes strain emm70]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAG
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACGGAGGAAGTGGTGGAAGAGG
TGCTGGTGGAATTAGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAG
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACGGAGGAAGTGGTGGAAGAGG
TGCTGGTGGAATTAGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
86.207 |
98.305 |
0.847 |
| prx | Streptococcus pyogenes MGAS8232 |
86.207 |
98.305 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
69.492 |
0.559 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |