Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LP314_RS06565 | Genome accession | NZ_CP032757 |
| Coordinates | 1415667..1416128 (+) | Length | 153 a.a. |
| NCBI ID | WP_056953066.1 | Uniprot ID | - |
| Organism | Lactiplantibacillus pentosus strain DSM 20314 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1406987..1447281 | 1415667..1416128 | within | 0 |
Gene organization within MGE regions
Location: 1406987..1447281
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LP314_RS06490 (LP314_06490) | - | 1406987..1408117 (-) | 1131 | WP_056953056.1 | site-specific integrase | - |
| LP314_RS06500 (LP314_06500) | - | 1408823..1409446 (-) | 624 | WP_056953058.1 | hypothetical protein | - |
| LP314_RS06505 (LP314_06505) | - | 1409556..1410122 (-) | 567 | WP_056953059.1 | hypothetical protein | - |
| LP314_RS06510 (LP314_06510) | - | 1410217..1410648 (-) | 432 | WP_003643876.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LP314_RS06515 (LP314_06515) | - | 1410658..1411038 (-) | 381 | WP_050339954.1 | helix-turn-helix domain-containing protein | - |
| LP314_RS06520 (LP314_06520) | - | 1411309..1411491 (+) | 183 | WP_050339955.1 | helix-turn-helix transcriptional regulator | - |
| LP314_RS06525 (LP314_06525) | - | 1411504..1412313 (+) | 810 | WP_056953060.1 | ORF6N domain-containing protein | - |
| LP314_RS06530 (LP314_06530) | - | 1412310..1412513 (+) | 204 | WP_050339957.1 | hypothetical protein | - |
| LP314_RS06535 (LP314_06535) | - | 1412513..1412851 (+) | 339 | WP_050339958.1 | DUF771 domain-containing protein | - |
| LP314_RS06540 (LP314_06540) | - | 1412965..1413204 (+) | 240 | WP_056953061.1 | hypothetical protein | - |
| LP314_RS06545 (LP314_06545) | - | 1413216..1413416 (+) | 201 | WP_050339960.1 | hypothetical protein | - |
| LP314_RS17235 | - | 1413428..1413592 (+) | 165 | WP_162985053.1 | hypothetical protein | - |
| LP314_RS06550 (LP314_06550) | - | 1413595..1414011 (+) | 417 | WP_056953063.1 | hypothetical protein | - |
| LP314_RS17240 | - | 1414014..1414184 (+) | 171 | WP_162985054.1 | hypothetical protein | - |
| LP314_RS06555 (LP314_06555) | - | 1414184..1415044 (+) | 861 | WP_056953064.1 | DUF1351 domain-containing protein | - |
| LP314_RS06560 (LP314_06560) | - | 1415044..1415670 (+) | 627 | WP_056953065.1 | ERF family protein | - |
| LP314_RS06565 (LP314_06565) | ssb | 1415667..1416128 (+) | 462 | WP_056953066.1 | single-stranded DNA-binding protein | Machinery gene |
| LP314_RS06570 (LP314_06570) | - | 1416143..1416835 (+) | 693 | WP_056953067.1 | putative HNHc nuclease | - |
| LP314_RS17440 | - | 1416882..1417649 (+) | 768 | WP_225366291.1 | replication protein | - |
| LP314_RS06580 (LP314_06580) | - | 1417649..1418434 (+) | 786 | WP_050339966.1 | ATP-binding protein | - |
| LP314_RS06585 (LP314_06585) | - | 1418570..1418872 (+) | 303 | WP_056953068.1 | hypothetical protein | - |
| LP314_RS06590 (LP314_06590) | - | 1418875..1419186 (+) | 312 | WP_056953070.1 | hypothetical protein | - |
| LP314_RS06595 (LP314_06595) | - | 1419190..1419348 (+) | 159 | WP_101809557.1 | hypothetical protein | - |
| LP314_RS17245 | - | 1419351..1419509 (+) | 159 | WP_162985055.1 | hypothetical protein | - |
| LP314_RS06600 (LP314_06600) | - | 1419675..1420109 (+) | 435 | WP_056953071.1 | YopX family protein | - |
| LP314_RS06605 (LP314_06605) | - | 1420106..1420591 (+) | 486 | WP_056953072.1 | DUF1642 domain-containing protein | - |
| LP314_RS06610 (LP314_06610) | - | 1420722..1421033 (+) | 312 | WP_056953073.1 | hypothetical protein | - |
| LP314_RS06615 (LP314_06615) | - | 1421045..1421458 (+) | 414 | WP_056953074.1 | hypothetical protein | - |
| LP314_RS06620 (LP314_06620) | - | 1421574..1422563 (+) | 990 | WP_056953075.1 | hypothetical protein | - |
| LP314_RS06625 (LP314_06625) | - | 1422644..1423366 (+) | 723 | WP_056953076.1 | hypothetical protein | - |
| LP314_RS06630 (LP314_06630) | - | 1423570..1424034 (+) | 465 | WP_056953077.1 | hypothetical protein | - |
| LP314_RS06635 (LP314_06635) | - | 1424097..1424333 (+) | 237 | WP_056953079.1 | hypothetical protein | - |
| LP314_RS06640 (LP314_06640) | - | 1424317..1424655 (+) | 339 | WP_056953080.1 | HNH endonuclease | - |
| LP314_RS06650 (LP314_06650) | - | 1424915..1425157 (+) | 243 | WP_056953082.1 | hypothetical protein | - |
| LP314_RS06655 (LP314_06655) | - | 1425268..1425555 (+) | 288 | WP_021730269.1 | P27 family phage terminase small subunit | - |
| LP314_RS06660 (LP314_06660) | - | 1425552..1427231 (+) | 1680 | WP_056953083.1 | terminase TerL endonuclease subunit | - |
| LP314_RS06665 (LP314_06665) | - | 1427250..1428392 (+) | 1143 | WP_021730267.1 | phage portal protein | - |
| LP314_RS06670 (LP314_06670) | - | 1428379..1429101 (+) | 723 | WP_027822442.1 | head maturation protease, ClpP-related | - |
| LP314_RS06675 (LP314_06675) | - | 1429124..1430296 (+) | 1173 | WP_021731060.1 | phage major capsid protein | - |
| LP314_RS06680 (LP314_06680) | - | 1430435..1430725 (+) | 291 | WP_225366292.1 | hypothetical protein | - |
| LP314_RS06685 (LP314_06685) | - | 1430697..1431095 (+) | 399 | WP_231128187.1 | hypothetical protein | - |
| LP314_RS06690 (LP314_06690) | - | 1431092..1431499 (+) | 408 | WP_056953085.1 | HK97 gp10 family phage protein | - |
| LP314_RS06695 (LP314_06695) | - | 1431496..1431918 (+) | 423 | WP_056953086.1 | hypothetical protein | - |
| LP314_RS06700 (LP314_06700) | - | 1431933..1432544 (+) | 612 | WP_021731062.1 | major tail protein | - |
| LP314_RS06705 (LP314_06705) | gpG | 1432638..1432952 (+) | 315 | WP_021731063.1 | phage tail assembly chaperone G | - |
| LP314_RS06715 (LP314_06715) | - | 1433216..1437760 (+) | 4545 | WP_056953087.1 | phage tail tape measure protein | - |
| LP314_RS06720 (LP314_06720) | - | 1437764..1438345 (+) | 582 | WP_225366293.1 | hypothetical protein | - |
| LP314_RS17445 | - | 1438371..1438586 (+) | 216 | WP_225366294.1 | hypothetical protein | - |
| LP314_RS06725 (LP314_06725) | - | 1438606..1441647 (+) | 3042 | WP_121243408.1 | phage tail protein | - |
| LP314_RS06730 (LP314_06730) | - | 1441654..1442577 (-) | 924 | WP_004271307.1 | IS30 family transposase | - |
| LP314_RS06735 (LP314_06735) | - | 1442604..1444550 (+) | 1947 | WP_162985056.1 | gp58-like family protein | - |
| LP314_RS06740 (LP314_06740) | - | 1444568..1445059 (+) | 492 | WP_021730684.1 | DUF1617 family protein | - |
| LP314_RS06745 (LP314_06745) | - | 1445061..1445507 (+) | 447 | WP_056952363.1 | hypothetical protein | - |
| LP314_RS06750 (LP314_06750) | - | 1445512..1445895 (+) | 384 | WP_033609296.1 | hypothetical protein | - |
| LP314_RS06755 (LP314_06755) | - | 1445898..1446092 (+) | 195 | WP_021730687.1 | hypothetical protein | - |
| LP314_RS06760 (LP314_06760) | - | 1446092..1446376 (+) | 285 | WP_054396940.1 | phage holin family protein | - |
| LP314_RS06765 (LP314_06765) | - | 1446376..1447281 (+) | 906 | WP_099722285.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 17254.67 Da Isoelectric Point: 5.9811
>NTDB_id=318546 LP314_RS06565 WP_056953066.1 1415667..1416128(+) (ssb) [Lactiplantibacillus pentosus strain DSM 20314]
MINRSVLVGRLTRDPELRYTNGGAAVATFTIAVNRQFTNQNGEREADFISCVIWRKAAENFTNFTHKGSLIGIDGHIQTR
NYENQQGTRIYVTEVVVDNFSLLESRAESEHHQSANSNDHSSNNSNNRKYDNSQNQYGNNGGQIDITDNDLPF
MINRSVLVGRLTRDPELRYTNGGAAVATFTIAVNRQFTNQNGEREADFISCVIWRKAAENFTNFTHKGSLIGIDGHIQTR
NYENQQGTRIYVTEVVVDNFSLLESRAESEHHQSANSNDHSSNNSNNRKYDNSQNQYGNNGGQIDITDNDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=318546 LP314_RS06565 WP_056953066.1 1415667..1416128(+) (ssb) [Lactiplantibacillus pentosus strain DSM 20314]
ATGATTAACCGAAGCGTTTTAGTTGGTAGGCTTACAAGAGACCCAGAATTACGTTATACGAATGGCGGTGCTGCGGTTGC
AACGTTCACGATTGCTGTAAATCGTCAATTTACAAATCAAAATGGAGAACGTGAAGCTGATTTTATTAGCTGTGTCATCT
GGCGGAAGGCTGCTGAAAATTTCACTAATTTCACACATAAAGGATCACTTATTGGAATTGATGGTCACATTCAAACGAGA
AACTATGAAAATCAGCAGGGAACTCGTATTTACGTTACTGAAGTAGTCGTTGATAACTTCTCATTGCTTGAATCACGTGC
TGAATCTGAACATCATCAAAGTGCTAATAGTAATGACCACAGCTCAAACAATAGCAACAATAGAAAATATGATAACAGTC
AAAACCAGTATGGAAATAATGGCGGCCAGATTGATATTACGGACAATGACTTGCCATTTTAA
ATGATTAACCGAAGCGTTTTAGTTGGTAGGCTTACAAGAGACCCAGAATTACGTTATACGAATGGCGGTGCTGCGGTTGC
AACGTTCACGATTGCTGTAAATCGTCAATTTACAAATCAAAATGGAGAACGTGAAGCTGATTTTATTAGCTGTGTCATCT
GGCGGAAGGCTGCTGAAAATTTCACTAATTTCACACATAAAGGATCACTTATTGGAATTGATGGTCACATTCAAACGAGA
AACTATGAAAATCAGCAGGGAACTCGTATTTACGTTACTGAAGTAGTCGTTGATAACTTCTCATTGCTTGAATCACGTGC
TGAATCTGAACATCATCAAAGTGCTAATAGTAATGACCACAGCTCAAACAATAGCAACAATAGAAAATATGATAACAGTC
AAAACCAGTATGGAAATAATGGCGGCCAGATTGATATTACGGACAATGACTTGCCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
62.353 |
100 |
0.693 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.608 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
69.281 |
0.379 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
52.778 |
70.588 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
52.778 |
70.588 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
51.852 |
70.588 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
51.852 |
70.588 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
51.852 |
70.588 |
0.366 |
| ssbB/cilA | Streptococcus mitis SK321 |
51.852 |
70.588 |
0.366 |