Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | D7D53_RS09100 | Genome accession | NZ_CP032621 |
| Coordinates | 1798770..1798892 (+) | Length | 40 a.a. |
| NCBI ID | WP_120770760.1 | Uniprot ID | A0A387AZH7 |
| Organism | Streptococcus gwangjuensis strain KCOM 1679 (=ChDC B345) | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1793770..1803892
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D7D53_RS09075 (D7D53_09075) | dnaA | 1794252..1795613 (-) | 1362 | WP_120770756.1 | chromosomal replication initiator protein DnaA | - |
| D7D53_RS09080 (D7D53_09080) | spo0J | 1795826..1796584 (-) | 759 | WP_120770757.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| D7D53_RS09085 (D7D53_09085) | htrA | 1796642..1797823 (-) | 1182 | WP_120770758.1 | S1C family serine protease | Regulator |
| D7D53_RS09090 (D7D53_09090) | rlmH | 1798007..1798486 (+) | 480 | WP_120770759.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| D7D53_RS09100 (D7D53_09100) | comC/comC2 | 1798770..1798892 (+) | 123 | WP_120770760.1 | competence-stimulating peptide ComC | Regulator |
| D7D53_RS09105 (D7D53_09105) | comD/comD2 | 1798909..1800258 (+) | 1350 | WP_120770761.1 | competence system sensor histidine kinase ComD | Regulator |
| D7D53_RS09110 (D7D53_09110) | comE | 1800255..1801007 (+) | 753 | WP_033682534.1 | competence system response regulator transcription factor ComE | Regulator |
| D7D53_RS09125 (D7D53_09125) | - | 1801250..1801792 (-) | 543 | WP_049552685.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4703.61 Da Isoelectric Point: 11.0075
>NTDB_id=317228 D7D53_RS09100 WP_120770760.1 1798770..1798892(+) (comC/comC2) [Streptococcus gwangjuensis strain KCOM 1679 (=ChDC B345)]
MKNTVKLEQFVALKEKDLQKIQGGDVRKTFGSFVFLFKKR
MKNTVKLEQFVALKEKDLQKIQGGDVRKTFGSFVFLFKKR
Nucleotide
Download Length: 123 bp
>NTDB_id=317228 D7D53_RS09100 WP_120770760.1 1798770..1798892(+) (comC/comC2) [Streptococcus gwangjuensis strain KCOM 1679 (=ChDC B345)]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGATGTTCG
AAAAACTTTTGGTTCTTTCGTATTTCTATTTAAAAAAAGATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGATGTTCG
AAAAACTTTTGGTTCTTTCGTATTTCTATTTAAAAAAAGATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae D39 |
70.732 |
100 |
0.725 |
| comC/comC2 | Streptococcus pneumoniae A66 |
70.732 |
100 |
0.725 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
70.732 |
100 |
0.725 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
70.732 |
100 |
0.725 |
| comC/comC1 | Streptococcus pneumoniae R6 |
70.732 |
100 |
0.725 |
| comC/comC1 | Streptococcus pneumoniae G54 |
70.732 |
100 |
0.725 |
| comC | Streptococcus mitis SK321 |
67.5 |
100 |
0.675 |
| comC | Streptococcus mitis NCTC 12261 |
62.5 |
100 |
0.625 |
| comC | Streptococcus sinensis strain Forsyth1A |
50 |
85 |
0.425 |