Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LLWM1_RS11385 | Genome accession | NZ_CP032500 |
| Coordinates | 2217841..2218110 (-) | Length | 89 a.a. |
| NCBI ID | WP_003129998.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain WM1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2214850..2252892 | 2217841..2218110 | within | 0 |
Gene organization within MGE regions
Location: 2214850..2252892
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLWM1_RS11355 (LLWM1_2174) | - | 2214850..2215287 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLWM1_RS11360 (LLWM1_2175) | - | 2215494..2216441 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| LLWM1_RS11365 (LLWM1_2176) | comGG | 2216415..2216741 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLWM1_RS11370 (LLWM1_2177) | comGF | 2216791..2217219 (-) | 429 | Protein_2212 | competence type IV pilus minor pilin ComGF | - |
| LLWM1_RS11375 (LLWM1_2178) | comGE | 2217182..2217478 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLWM1_RS11380 (LLWM1_2179) | comGD | 2217450..2217881 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLWM1_RS11385 (LLWM1_2180) | comGC | 2217841..2218110 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLWM1_RS11390 (LLWM1_2181) | - | 2218237..2218929 (-) | 693 | WP_152994386.1 | hypothetical protein | - |
| LLWM1_RS11395 (LLWM1_2182) | - | 2219171..2219950 (-) | 780 | WP_082225220.1 | peptidoglycan amidohydrolase family protein | - |
| LLWM1_RS11400 (LLWM1_2183) | - | 2219950..2220249 (-) | 300 | WP_031559226.1 | phage holin | - |
| LLWM1_RS11405 (LLWM1_2184) | - | 2220262..2220612 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| LLWM1_RS11410 (LLWM1_2185) | - | 2220625..2220861 (-) | 237 | WP_082225257.1 | hypothetical protein | - |
| LLWM1_RS11415 (LLWM1_2186) | - | 2220873..2225138 (-) | 4266 | WP_243525488.1 | hypothetical protein | - |
| LLWM1_RS11420 (LLWM1_2187) | - | 2225117..2226646 (-) | 1530 | WP_003131327.1 | distal tail protein Dit | - |
| LLWM1_RS11425 (LLWM1_2188) | - | 2226656..2229265 (-) | 2610 | WP_058221395.1 | phage tail tape measure protein | - |
| LLWM1_RS11430 (LLWM1_2189) | - | 2229255..2229962 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| LLWM1_RS11435 (LLWM1_2190) | - | 2229978..2230385 (-) | 408 | WP_058221396.1 | hypothetical protein | - |
| LLWM1_RS11440 (LLWM1_2191) | - | 2230442..2230918 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| LLWM1_RS11445 (LLWM1_2192) | - | 2230929..2231363 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LLWM1_RS11450 (LLWM1_2193) | - | 2231363..2231692 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LLWM1_RS11455 (LLWM1_2194) | - | 2231689..2232033 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LLWM1_RS11460 (LLWM1_2195) | - | 2232023..2232424 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LLWM1_RS11465 (LLWM1_2196) | - | 2232498..2232734 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| LLWM1_RS11470 (LLWM1_2197) | - | 2232763..2233680 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| LLWM1_RS11475 (LLWM1_2198) | - | 2233695..2234744 (-) | 1050 | WP_003131314.1 | XkdF-like putative serine protease domain-containing protein | - |
| LLWM1_RS11480 (LLWM1_2199) | - | 2234760..2235590 (-) | 831 | WP_003131311.1 | phage minor head protein | - |
| LLWM1_RS11485 (LLWM1_2200) | - | 2235583..2237112 (-) | 1530 | WP_058221397.1 | phage portal protein | - |
| LLWM1_RS11490 (LLWM1_2201) | terL | 2237125..2238576 (-) | 1452 | WP_014570551.1 | phage terminase large subunit | - |
| LLWM1_RS11495 (LLWM1_2202) | - | 2238557..2239030 (-) | 474 | WP_058221398.1 | transposase | - |
| LLWM1_RS11500 (LLWM1_2203) | - | 2239201..2239590 (-) | 390 | WP_058221399.1 | DUF722 domain-containing protein | - |
| LLWM1_RS11505 (LLWM1_2204) | - | 2239667..2239975 (-) | 309 | WP_082225258.1 | hypothetical protein | - |
| LLWM1_RS11510 (LLWM1_2205) | - | 2240104..2240319 (-) | 216 | WP_058221541.1 | DUF1660 domain-containing protein | - |
| LLWM1_RS11515 (LLWM1_2206) | - | 2240316..2240534 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| LLWM1_RS11520 (LLWM1_2207) | - | 2240553..2241272 (-) | 720 | WP_082225259.1 | hypothetical protein | - |
| LLWM1_RS11525 (LLWM1_2208) | - | 2241299..2241658 (-) | 360 | WP_082225260.1 | hypothetical protein | - |
| LLWM1_RS11530 (LLWM1_2209) | dut | 2241662..2242081 (-) | 420 | WP_082225261.1 | dUTP diphosphatase | - |
| LLWM1_RS11535 (LLWM1_2210) | - | 2242078..2242443 (-) | 366 | WP_082225262.1 | DUF1642 domain-containing protein | - |
| LLWM1_RS11540 (LLWM1_2211) | - | 2242440..2242982 (-) | 543 | WP_145952586.1 | DUF1642 domain-containing protein | - |
| LLWM1_RS11545 (LLWM1_03185) | - | 2242975..2243157 (-) | 183 | WP_243525495.1 | hypothetical protein | - |
| LLWM1_RS11550 (LLWM1_2212) | - | 2243176..2243334 (-) | 159 | WP_228763273.1 | hypothetical protein | - |
| LLWM1_RS11555 (LLWM1_2213) | - | 2243526..2243732 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| LLWM1_RS11560 (LLWM1_2214) | - | 2243840..2244250 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| LLWM1_RS11565 (LLWM1_03190) | - | 2244263..2244535 (-) | 273 | WP_145952588.1 | L-rhamnose isomerase | - |
| LLWM1_RS11570 (LLWM1_2215) | - | 2244498..2244659 (-) | 162 | WP_158521330.1 | hypothetical protein | - |
| LLWM1_RS11575 (LLWM1_2216) | - | 2244698..2245624 (-) | 927 | WP_058221710.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLWM1_RS11580 (LLWM1_2217) | - | 2245887..2246954 (-) | 1068 | WP_058221711.1 | DUF1351 domain-containing protein | - |
| LLWM1_RS11585 (LLWM1_2218) | bet | 2246956..2247693 (-) | 738 | WP_058212836.1 | phage recombination protein Bet | - |
| LLWM1_RS11590 (LLWM1_2219) | - | 2247800..2247976 (-) | 177 | WP_032943269.1 | putative transcriptional regulator | - |
| LLWM1_RS11595 (LLWM1_2220) | - | 2247973..2248221 (-) | 249 | WP_058221712.1 | hypothetical protein | - |
| LLWM1_RS11600 (LLWM1_03195) | - | 2248234..2248356 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LLWM1_RS11605 (LLWM1_2221) | - | 2248353..2248535 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LLWM1_RS11610 (LLWM1_2222) | - | 2248551..2249240 (-) | 690 | WP_058221713.1 | Rha family transcriptional regulator | - |
| LLWM1_RS11615 (LLWM1_2223) | - | 2249299..2249532 (-) | 234 | WP_014570819.1 | helix-turn-helix transcriptional regulator | - |
| LLWM1_RS11620 (LLWM1_2224) | - | 2249709..2250119 (+) | 411 | WP_014570820.1 | helix-turn-helix domain-containing protein | - |
| LLWM1_RS11625 (LLWM1_2225) | - | 2250130..2250714 (+) | 585 | WP_058221714.1 | hypothetical protein | - |
| LLWM1_RS11630 (LLWM1_2226) | - | 2250770..2251309 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| LLWM1_RS11635 (LLWM1_2227) | - | 2251435..2252892 (+) | 1458 | WP_058221720.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10123.56 Da Isoelectric Point: 4.2950
>NTDB_id=316484 LLWM1_RS11385 WP_003129998.1 2217841..2218110(-) (comGC) [Lactococcus lactis subsp. lactis strain WM1]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=316484 LLWM1_RS11385 WP_003129998.1 2217841..2218110(-) (comGC) [Lactococcus lactis subsp. lactis strain WM1]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
86.667 |
84.27 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.471 |
95.506 |
0.539 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
53.947 |
85.393 |
0.461 |
| comYC | Streptococcus mutans UA140 |
50.685 |
82.022 |
0.416 |
| comYC | Streptococcus mutans UA159 |
50.685 |
82.022 |
0.416 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
56.25 |
71.91 |
0.404 |