Detailed information NTG0315510

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: D5R92_RS06440
• Genome accession: NZ_CP032401
• Coordinates: 1297163..1297489 (+)
• Length: 108 a.a.
• NCBI ID: WP_003098806.1
• Uniprot ID: -
• Organism: Streptococcus iniae strain GX005
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1292163..1302489

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D5R92_RS06425 (D5R92_06425)	-	1294828..1295193 (+)	366	WP_003098799.1	DUF1033 family protein	-
D5R92_RS06430 (D5R92_06430)	comYA	1295254..1296195 (+)	942	WP_003098801.1	competence type IV pilus ATPase ComGA	Machinery gene
D5R92_RS06435 (D5R92_06435)	comYB	1296146..1297162 (+)	1017	WP_003098804.1	competence type IV pilus assembly protein ComGB	Machinery gene
D5R92_RS06440 (D5R92_06440)	comGC/cglC	1297163..1297489 (+)	327	WP_003098806.1	competence type IV pilus major pilin ComGC	Machinery gene
D5R92_RS10310 (D5R92_06445)	comGD	1297449..1297877 (+)	429	WP_003098807.1	competence type IV pilus minor pilin ComGD	-
D5R92_RS06450 (D5R92_06450)	comGE	1297849..1298142 (+)	294	WP_031239176.1	competence type IV pilus minor pilin ComGE	-
D5R92_RS06455 (D5R92_06455)	comGF	1298171..1298551 (+)	381	WP_003098811.1	competence type IV pilus minor pilin ComGF	-
D5R92_RS06460 (D5R92_06460)	comGG	1298541..1298894 (+)	354	WP_003098812.1	competence type IV pilus minor pilin ComGG	-
D5R92_RS06465 (D5R92_06465)	comYH	1298956..1299912 (+)	957	WP_003098815.1	class I SAM-dependent methyltransferase	Machinery gene
D5R92_RS06470 (D5R92_06470)	-	1299969..1301165 (+)	1197	WP_003098816.1	acetate kinase	-
D5R92_RS06475 (D5R92_06475)	-	1301288..1301491 (+)	204	WP_003098819.1	helix-turn-helix transcriptional regulator	-
D5R92_RS06480 (D5R92_06480)	-	1301504..1301956 (+)	453	WP_003098820.1	hypothetical protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12153.19 Da
• Isoelectric Point: 10.0312

>NTDB_id=315510 D5R92_RS06440 WP_003098806.1 1297163..1297489(+) (comGC/cglC) [Streptococcus iniae strain GX005]
MKTKCKQLKESRTKAFTLLEMLIVLLIISVLMLLFIPNLSKQKDKVTDAGNAAVVKIVENQAELYELTEGGKASLAQLQS
KGHITDKQAKAYQDYYAKNSDKHRQVNN

Nucleotide

• Length: 327 bp

>NTDB_id=315510 D5R92_RS06440 WP_003098806.1 1297163..1297489(+) (comGC/cglC) [Streptococcus iniae strain GX005]
ATGAAAACAAAATGTAAACAACTAAAAGAAAGCCGTACTAAAGCTTTCACACTTCTAGAAATGTTGATTGTTTTGCTAAT
TATTAGTGTTCTTATGCTACTGTTTATTCCGAATTTAAGTAAGCAAAAAGATAAGGTTACAGATGCTGGTAATGCTGCAG
TGGTTAAAATTGTTGAAAATCAGGCGGAACTATATGAATTAACGGAAGGTGGGAAAGCAAGCCTCGCTCAACTCCAATCA
AAAGGTCATATTACAGACAAACAAGCGAAGGCTTATCAGGATTATTATGCCAAAAACAGTGACAAGCATAGACAAGTTAA
CAACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (12-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae TIGR4	59.259	100	0.593
comGC/cglC	Streptococcus pneumoniae D39	59.259	100	0.593
comGC/cglC	Streptococcus pneumoniae R6	59.259	100	0.593
comGC/cglC	Streptococcus pneumoniae Rx1	59.259	100	0.593
comGC/cglC	Streptococcus mitis SK321	63.366	93.519	0.593
comYC	Streptococcus gordonii str. Challis substr. CH1	61.165	95.37	0.583
comYC	Streptococcus mutans UA140	59.223	95.37	0.565
comYC	Streptococcus mutans UA159	59.223	95.37	0.565
comGC/cglC	Streptococcus mitis NCTC 12261	64.835	84.259	0.546
comGC	Lactococcus lactis subsp. cremoris KW2	51.376	100	0.519
comYC	Streptococcus suis isolate S10	60.92	80.556	0.491