Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | D1E87_RS10830 | Genome accession | NZ_CP031890 |
| Coordinates | 2111132..2111602 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain CFSAN082781 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2081568..2137380 | 2111132..2111602 | within | 0 |
Gene organization within MGE regions
Location: 2081568..2137380
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1E87_RS10610 (D1E87_10845) | scn | 2081568..2081918 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| D1E87_RS10615 (D1E87_10850) | - | 2082467..2082916 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| D1E87_RS10620 (D1E87_10855) | - | 2083011..2083349 (-) | 339 | Protein_2010 | SH3 domain-containing protein | - |
| D1E87_RS10630 (D1E87_10865) | sak | 2083996..2084487 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| D1E87_RS10635 (D1E87_10870) | - | 2084678..2085433 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| D1E87_RS10640 (D1E87_10875) | - | 2085445..2085699 (-) | 255 | WP_000611512.1 | phage holin | - |
| D1E87_RS10645 (D1E87_10880) | - | 2085751..2085858 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| D1E87_RS10650 (D1E87_10885) | pepG1 | 2085911..2086045 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| D1E87_RS10655 (D1E87_10890) | - | 2086237..2086533 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| D1E87_RS10660 (D1E87_10895) | - | 2086591..2086878 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| D1E87_RS10665 (D1E87_10900) | - | 2086925..2087077 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| D1E87_RS10670 (D1E87_10905) | - | 2087067..2090852 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| D1E87_RS10675 (D1E87_10910) | - | 2090868..2092352 (-) | 1485 | WP_000567394.1 | phage distal tail protein | - |
| D1E87_RS10680 (D1E87_10915) | - | 2092349..2096878 (-) | 4530 | WP_001551779.1 | phage tail tape measure protein | - |
| D1E87_RS14995 | gpGT | 2096935..2097072 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| D1E87_RS10685 (D1E87_10920) | gpG | 2097123..2097473 (-) | 351 | WP_001096354.1 | phage tail assembly chaperone G | - |
| D1E87_RS10690 (D1E87_10925) | - | 2097523..2097762 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| D1E87_RS10695 (D1E87_10930) | - | 2097789..2098433 (-) | 645 | WP_000260578.1 | major tail protein | - |
| D1E87_RS10700 (D1E87_10935) | - | 2098437..2098841 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| D1E87_RS10705 (D1E87_10940) | - | 2098838..2099242 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| D1E87_RS10710 (D1E87_10945) | - | 2099239..2099601 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| D1E87_RS10715 (D1E87_10950) | - | 2099585..2099869 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| D1E87_RS10720 (D1E87_10955) | - | 2099859..2100143 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| D1E87_RS10725 (D1E87_10960) | - | 2100163..2101308 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| D1E87_RS10730 (D1E87_10965) | - | 2101332..2102069 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| D1E87_RS10735 (D1E87_10970) | - | 2102053..2103240 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| D1E87_RS10740 (D1E87_10975) | - | 2103256..2104917 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| D1E87_RS10745 (D1E87_10980) | - | 2104914..2105258 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| D1E87_RS10750 (D1E87_10985) | - | 2105388..2105687 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| D1E87_RS10755 (D1E87_10990) | - | 2105919..2106335 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| D1E87_RS10760 (D1E87_10995) | - | 2106363..2106563 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| D1E87_RS10765 (D1E87_11000) | rinB | 2106563..2106712 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| D1E87_RS10770 (D1E87_11005) | - | 2106709..2107095 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| D1E87_RS10775 (D1E87_11010) | - | 2107092..2107298 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| D1E87_RS10780 (D1E87_11015) | - | 2107295..2107540 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| D1E87_RS10785 (D1E87_11020) | - | 2107577..2108110 (-) | 534 | WP_000181819.1 | dUTP diphosphatase | - |
| D1E87_RS10790 (D1E87_11025) | - | 2108103..2108345 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| D1E87_RS10795 (D1E87_11030) | - | 2108335..2108571 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| D1E87_RS10800 (D1E87_11035) | - | 2108564..2108935 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| D1E87_RS10805 (D1E87_11040) | - | 2108944..2109186 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| D1E87_RS10810 (D1E87_11045) | - | 2109190..2109558 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| D1E87_RS10815 (D1E87_11050) | - | 2109571..2109975 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| D1E87_RS10820 (D1E87_11055) | - | 2109984..2110202 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| D1E87_RS10825 (D1E87_11060) | - | 2110209..2111102 (-) | 894 | WP_000148333.1 | DnaD domain protein | - |
| D1E87_RS10830 (D1E87_11065) | ssbA | 2111132..2111602 (-) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| D1E87_RS10835 (D1E87_11070) | - | 2111603..2112220 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| D1E87_RS10840 (D1E87_11075) | - | 2112301..2113221 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| D1E87_RS10845 (D1E87_11080) | - | 2113223..2115166 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| D1E87_RS10850 (D1E87_11085) | - | 2115175..2115438 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| D1E87_RS10855 (D1E87_11090) | - | 2115447..2115707 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| D1E87_RS10860 (D1E87_11095) | - | 2115747..2116007 (-) | 261 | WP_001549178.1 | DUF2482 family protein | - |
| D1E87_RS10865 (D1E87_11100) | - | 2116102..2116263 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| D1E87_RS10870 (D1E87_11105) | - | 2116260..2116580 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| D1E87_RS10875 (D1E87_11110) | - | 2116639..2116869 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| D1E87_RS15000 | - | 2116866..2117042 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| D1E87_RS10880 (D1E87_11115) | - | 2117058..2117810 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| D1E87_RS10885 (D1E87_11120) | - | 2117861..2118190 (+) | 330 | WP_149557715.1 | hypothetical protein | - |
| D1E87_RS10890 (D1E87_11125) | - | 2118179..2118394 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| D1E87_RS10895 (D1E87_11130) | - | 2118410..2118673 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| D1E87_RS10900 (D1E87_11135) | - | 2118670..2118843 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| D1E87_RS10905 (D1E87_11140) | - | 2118806..2119519 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| D1E87_RS10910 (D1E87_11145) | - | 2119535..2120467 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| D1E87_RS10915 (D1E87_11150) | - | 2120473..2120814 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| D1E87_RS10920 (D1E87_11155) | - | 2121018..2121200 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| D1E87_RS10925 (D1E87_11160) | - | 2121278..2121991 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| D1E87_RS10930 (D1E87_11165) | - | 2122182..2123219 (+) | 1038 | WP_000857199.1 | tyrosine-type recombinase/integrase | - |
| D1E87_RS10935 (D1E87_11170) | sph | 2123276..2124100 (+) | 825 | Protein_2074 | sphingomyelin phosphodiesterase | - |
| D1E87_RS10940 (D1E87_11175) | lukG | 2124338..2125354 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| D1E87_RS10945 (D1E87_11180) | lukH | 2125376..2126431 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| D1E87_RS10950 (D1E87_11185) | - | 2126866..2128089 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| D1E87_RS10955 (D1E87_11190) | - | 2128461..2129306 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| D1E87_RS10960 (D1E87_11195) | - | 2129368..2130279 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| D1E87_RS10965 (D1E87_11200) | - | 2130440..2131747 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| D1E87_RS10975 (D1E87_11210) | - | 2132600..2133043 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| D1E87_RS10980 (D1E87_11215) | - | 2133149..2133585 (-) | 437 | Protein_2082 | hypothetical protein | - |
| D1E87_RS10985 (D1E87_11220) | - | 2133903..2134493 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| D1E87_RS10990 (D1E87_11225) | - | 2134490..2134702 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| D1E87_RS10995 (D1E87_11230) | - | 2134763..2135309 (+) | 547 | Protein_2085 | site-specific integrase | - |
| D1E87_RS11000 (D1E87_11235) | groL | 2135404..2137020 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| D1E87_RS11005 (D1E87_11240) | groES | 2137096..2137380 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=312511 D1E87_RS10830 WP_000934753.1 2111132..2111602(-) (ssbA) [Staphylococcus aureus strain CFSAN082781]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=312511 D1E87_RS10830 WP_000934753.1 2111132..2111602(-) (ssbA) [Staphylococcus aureus strain CFSAN082781]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |