Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   CSB81_RS03885 Genome accession   NZ_CP029667
Coordinates   696030..696500 (+) Length   156 a.a.
NCBI ID   WP_000934753.1    Uniprot ID   A0A1S5YP95
Organism   Staphylococcus aureus strain AR_0225     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 670251..726200 696030..696500 within 0


Gene organization within MGE regions


Location: 670251..726200
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CSB81_RS03710 (CSB81_0640) groES 670251..670535 (+) 285 WP_000917289.1 co-chaperone GroES -
  CSB81_RS03715 (CSB81_0641) groL 670611..672227 (+) 1617 WP_000240645.1 chaperonin GroEL -
  CSB81_RS03720 - 672322..672868 (-) 547 Protein_660 site-specific integrase -
  CSB81_RS03725 - 672929..673141 (+) 213 WP_000128898.1 hypothetical protein -
  CSB81_RS03730 (CSB81_0642) - 673138..673728 (+) 591 WP_001293058.1 terminase small subunit -
  CSB81_RS03735 (CSB81_0643) - 674046..674482 (+) 437 Protein_663 hypothetical protein -
  CSB81_RS03740 (CSB81_0644) - 674588..675031 (+) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  CSB81_RS03750 (CSB81_0645) - 675884..677191 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  CSB81_RS03755 (CSB81_0646) - 677352..678263 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  CSB81_RS03760 (CSB81_0647) - 678325..679170 (+) 846 WP_000812010.1 class I SAM-dependent methyltransferase -
  CSB81_RS03765 (CSB81_0648) - 679542..680765 (-) 1224 WP_000206639.1 ArgE/DapE family deacylase -
  CSB81_RS03770 (CSB81_0649) lukH 681200..682255 (+) 1056 WP_000791407.1 bi-component leukocidin LukGH subunit H -
  CSB81_RS03775 (CSB81_0650) lukG 682277..683293 (+) 1017 WP_000595324.1 bi-component leukocidin LukGH subunit G -
  CSB81_RS03780 (CSB81_0651) sph 683531..684361 (-) 831 Protein_671 sphingomyelin phosphodiesterase -
  CSB81_RS03785 (CSB81_0652) - 684412..685449 (-) 1038 WP_000857199.1 site-specific integrase -
  CSB81_RS03790 (CSB81_0653) - 685640..686353 (-) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  CSB81_RS03795 (CSB81_0654) - 686431..686613 (-) 183 WP_000705246.1 hypothetical protein -
  CSB81_RS03800 - 686817..687158 (-) 342 WP_000591749.1 hypothetical protein -
  CSB81_RS03805 (CSB81_0655) - 687164..688096 (-) 933 WP_000759682.1 exonuclease domain-containing protein -
  CSB81_RS03810 (CSB81_0656) - 688112..688825 (-) 714 WP_001031454.1 XRE family transcriptional regulator -
  CSB81_RS03815 - 688788..688962 (+) 175 Protein_678 transcriptional regulator -
  CSB81_RS03820 (CSB81_0657) - 688959..689222 (+) 264 WP_000854072.1 helix-turn-helix transcriptional regulator -
  CSB81_RS03825 - 689238..689453 (+) 216 WP_001025404.1 MW1434 family type I TA system toxin -
  CSB81_RS03830 (CSB81_0658) - 689442..689771 (-) 330 WP_000180411.1 hypothetical protein -
  CSB81_RS03835 (CSB81_0659) - 689822..690574 (+) 753 WP_001148642.1 phage antirepressor KilAC domain-containing protein -
  CSB81_RS15540 (CSB81_0660) - 690590..690766 (+) 177 WP_001001356.1 hypothetical protein -
  CSB81_RS03840 (CSB81_0661) - 690763..690993 (-) 231 WP_000549548.1 hypothetical protein -
  CSB81_RS03845 (CSB81_0662) - 691052..691372 (+) 321 WP_001120199.1 DUF771 domain-containing protein -
  CSB81_RS03850 (CSB81_0663) - 691369..691530 (+) 162 WP_001285960.1 DUF1270 domain-containing protein -
  CSB81_RS03855 (CSB81_0664) - 691625..691944 (+) 320 Protein_687 DUF2482 family protein -
  CSB81_RS03860 (CSB81_0665) - 691925..692185 (+) 261 WP_000291513.1 DUF1108 family protein -
  CSB81_RS03865 - 692194..692457 (+) 264 WP_001205732.1 hypothetical protein -
  CSB81_RS03870 (CSB81_0666) - 692466..694409 (+) 1944 WP_000700561.1 AAA family ATPase -
  CSB81_RS03875 (CSB81_0667) - 694411..695331 (+) 921 WP_000138475.1 recombinase RecT -
  CSB81_RS03880 (CSB81_0668) - 695412..696029 (+) 618 WP_071665632.1 MBL fold metallo-hydrolase -
  CSB81_RS03885 (CSB81_0669) ssbA 696030..696500 (+) 471 WP_000934753.1 single-stranded DNA-binding protein Machinery gene
  CSB81_RS03890 (CSB81_0670) - 696530..697423 (+) 894 WP_000148333.1 DnaD domain-containing protein -
  CSB81_RS03895 (CSB81_0671) - 697430..697648 (+) 219 WP_000338530.1 hypothetical protein -
  CSB81_RS03900 (CSB81_0672) - 697657..698061 (+) 405 WP_000401977.1 RusA family crossover junction endodeoxyribonuclease -
  CSB81_RS03905 (CSB81_0673) - 698074..698442 (+) 369 WP_000101288.1 SA1788 family PVL leukocidin-associated protein -
  CSB81_RS03910 (CSB81_0674) - 698446..698688 (+) 243 WP_000131383.1 phi PVL orf 51-like protein -
  CSB81_RS03915 (CSB81_0675) - 698697..699068 (+) 372 WP_001549172.1 hypothetical protein -
  CSB81_RS03920 (CSB81_0676) - 699061..699297 (+) 237 WP_001065101.1 DUF1024 family protein -
  CSB81_RS03925 (CSB81_0677) - 699287..699529 (+) 243 WP_000700108.1 hypothetical protein -
  CSB81_RS03930 (CSB81_0678) - 699522..700055 (+) 534 WP_000181819.1 dUTP pyrophosphatase -
  CSB81_RS03935 - 700092..700337 (+) 246 WP_001282074.1 hypothetical protein -
  CSB81_RS03940 (CSB81_0680) - 700334..700540 (+) 207 WP_000195803.1 DUF1381 domain-containing protein -
  CSB81_RS03945 (CSB81_0681) - 700537..700923 (+) 387 WP_000592207.1 hypothetical protein -
  CSB81_RS03950 (CSB81_0682) - 700920..701069 (+) 150 WP_000595265.1 transcriptional activator RinB -
  CSB81_RS03955 (CSB81_0683) - 701069..701269 (+) 201 WP_000265043.1 DUF1514 family protein -
  CSB81_RS03960 (CSB81_0684) - 701297..701713 (+) 417 WP_000590122.1 hypothetical protein -
  CSB81_RS03965 (CSB81_0685) - 701945..702244 (+) 300 WP_000988336.1 HNH endonuclease -
  CSB81_RS03970 (CSB81_0686) - 702374..702718 (+) 345 WP_000402904.1 hypothetical protein -
  CSB81_RS03975 (CSB81_0687) - 702715..704376 (+) 1662 WP_110230798.1 terminase large subunit -
  CSB81_RS03980 (CSB81_0688) - 704392..705579 (+) 1188 WP_000025274.1 phage portal protein -
  CSB81_RS03985 (CSB81_0689) - 705563..706300 (+) 738 WP_000642728.1 head maturation protease, ClpP-related -
  CSB81_RS03990 (CSB81_0690) - 706324..707469 (+) 1146 WP_000154559.1 phage major capsid protein -
  CSB81_RS03995 (CSB81_0691) - 707489..707773 (+) 285 WP_000238236.1 hypothetical protein -
  CSB81_RS04000 (CSB81_0692) - 707763..708047 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  CSB81_RS04005 (CSB81_0693) - 708031..708393 (+) 363 WP_000755150.1 head-tail adaptor protein -
  CSB81_RS04010 (CSB81_0694) - 708390..708794 (+) 405 WP_000114229.1 HK97 gp10 family phage protein -
  CSB81_RS04015 - 708791..709195 (+) 405 WP_000565500.1 hypothetical protein -
  CSB81_RS04020 (CSB81_0695) - 709199..709843 (+) 645 WP_000260578.1 major tail protein -
  CSB81_RS04025 - 709885..710109 (+) 225 WP_076035566.1 Ig-like domain-containing protein -
  CSB81_RS04030 (CSB81_0697) - 710159..710509 (+) 351 WP_001096354.1 hypothetical protein -
  CSB81_RS15545 (CSB81_0698) - 710560..710697 (+) 138 WP_001549167.1 hypothetical protein -
  CSB81_RS04035 (CSB81_0699) - 710754..715283 (+) 4530 WP_001549166.1 phage tail tape measure protein -
  CSB81_RS04040 (CSB81_0700) - 715280..716764 (+) 1485 WP_000567394.1 phage tail domain-containing protein -
  CSB81_RS04045 (CSB81_0701) - 716780..720565 (+) 3786 WP_110230799.1 phage tail spike protein -
  CSB81_RS04050 (CSB81_0702) - 720555..720707 (+) 153 WP_001153681.1 hypothetical protein -
  CSB81_RS04055 (CSB81_0703) - 720754..721041 (+) 288 WP_001040261.1 hypothetical protein -
  CSB81_RS04060 (CSB81_0704) - 721099..721395 (+) 297 WP_000539688.1 DUF2951 domain-containing protein -
  CSB81_RS04065 (CSB81_0705) pepG1 721587..721721 (+) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  CSB81_RS04070 - 721774..721881 (-) 108 WP_001791821.1 hypothetical protein -
  CSB81_RS04075 (CSB81_0706) - 721933..722187 (+) 255 WP_000611512.1 phage holin -
  CSB81_RS04080 (CSB81_0707) - 722199..722954 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  CSB81_RS04085 (CSB81_0708) sak 723145..723636 (+) 492 WP_000919350.1 staphylokinase -
  CSB81_RS04095 (CSB81_0709) - 724286..724621 (+) 336 Protein_735 SH3 domain-containing protein -
  CSB81_RS04100 (CSB81_0710) - 724716..725165 (-) 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
  CSB81_RS04105 (CSB81_0711) scn 725850..726200 (+) 351 WP_000702263.1 complement inhibitor SCIN-A -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17668.55 Da        Isoelectric Point: 5.2672

>NTDB_id=294869 CSB81_RS03885 WP_000934753.1 696030..696500(+) (ssbA) [Staphylococcus aureus strain AR_0225]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=294869 CSB81_RS03885 WP_000934753.1 696030..696500(+) (ssbA) [Staphylococcus aureus strain AR_0225]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1S5YP95

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

56.497

100

0.641

  ssb Latilactobacillus sakei subsp. sakei 23K

50

100

0.545

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

33.333

100

0.378

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssbB/cilA Streptococcus pneumoniae TIGR4

47.5

76.923

0.365

  ssbB/cilA Streptococcus mitis NCTC 12261

47.5

76.923

0.365


Multiple sequence alignment