Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | SK637_RS09665 | Genome accession | NZ_CP028415 |
| Coordinates | 1938946..1939068 (-) | Length | 40 a.a. |
| NCBI ID | WP_033689611.1 | Uniprot ID | O33668 |
| Organism | Streptococcus mitis strain SK637 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1933946..1944068
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SK637_RS09640 (SK637_01879) | - | 1936074..1936616 (+) | 543 | WP_033689607.1 | TetR/AcrR family transcriptional regulator | - |
| SK637_RS09655 (SK637_01882) | comE | 1936859..1937611 (-) | 753 | WP_000866062.1 | competence system response regulator transcription factor ComE | Regulator |
| SK637_RS09660 (SK637_01883) | comD/comD1 | 1937608..1938933 (-) | 1326 | WP_033689609.1 | competence system sensor histidine kinase ComD | Regulator |
| SK637_RS09665 (SK637_01884) | comC/comC2 | 1938946..1939068 (-) | 123 | WP_033689611.1 | competence-stimulating peptide ComC | Regulator |
| SK637_RS09675 (SK637_01886) | rlmH | 1939350..1939829 (-) | 480 | WP_000695939.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| SK637_RS09680 (SK637_01887) | htrA | 1940013..1941197 (+) | 1185 | WP_033689613.1 | S1C family serine protease | Regulator |
| SK637_RS09685 (SK637_01888) | spo0J | 1941255..1942013 (+) | 759 | WP_033689615.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4837.68 Da Isoelectric Point: 11.0668
>NTDB_id=284743 SK637_RS09665 WP_033689611.1 1938946..1939068(-) (comC/comC2) [Streptococcus mitis strain SK637]
MKNTVKLEQFVALKEKDLQKIQGGEMRKSNNNFFHFLRRI
MKNTVKLEQFVALKEKDLQKIQGGEMRKSNNNFFHFLRRI
Nucleotide
Download Length: 123 bp
>NTDB_id=284743 SK637_RS09665 WP_033689611.1 1938946..1939068(-) (comC/comC2) [Streptococcus mitis strain SK637]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAAATTCAAGGTGGGGAGATGAG
GAAATCAAATAATAATTTCTTTCATTTCTTAAGAAGAATATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAAATTCAAGGTGGGGAGATGAG
GAAATCAAATAATAATTTCTTTCATTTCTTAAGAAGAATATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
77.5 |
100 |
0.775 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
77.5 |
100 |
0.775 |
| comC | Streptococcus mitis SK321 |
72.5 |
100 |
0.725 |
| comC/comC1 | Streptococcus pneumoniae R6 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae G54 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae D39 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
93.103 |
72.5 |
0.675 |
| comC | Streptococcus mitis NCTC 12261 |
66.667 |
97.5 |
0.65 |