Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | CGZ53_RS00790 | Genome accession | NZ_CP022435 |
| Coordinates | 131604..131927 (+) | Length | 107 a.a. |
| NCBI ID | WP_012657675.1 | Uniprot ID | - |
| Organism | Streptococcus uberis strain NZ01 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 94713..135909 | 131604..131927 | within | 0 |
Gene organization within MGE regions
Location: 94713..135909
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGZ53_RS00635 (CGZ53_00635) | - | 94713..95849 (-) | 1137 | WP_100911831.1 | tyrosine-type recombinase/integrase | - |
| CGZ53_RS00640 (CGZ53_00640) | - | 95854..96048 (-) | 195 | WP_000562208.1 | DUF3173 family protein | - |
| CGZ53_RS00645 (CGZ53_00645) | - | 96117..97463 (-) | 1347 | WP_046387789.1 | Rep family protein | - |
| CGZ53_RS00650 (CGZ53_00650) | - | 97813..98172 (-) | 360 | WP_046387860.1 | hypothetical protein | - |
| CGZ53_RS00655 (CGZ53_00655) | - | 98187..98654 (-) | 468 | WP_233845126.1 | hypothetical protein | - |
| CGZ53_RS00660 (CGZ53_00660) | - | 98802..99410 (+) | 609 | WP_100911832.1 | helix-turn-helix domain-containing protein | - |
| CGZ53_RS00665 (CGZ53_00665) | - | 99632..100015 (+) | 384 | WP_046387791.1 | hypothetical protein | - |
| CGZ53_RS00670 (CGZ53_00670) | - | 100046..100702 (+) | 657 | WP_046387792.1 | thioredoxin family protein | - |
| CGZ53_RS09525 (CGZ53_00675) | - | 101351..101726 (+) | 376 | Protein_98 | helix-turn-helix domain-containing protein | - |
| CGZ53_RS00680 (CGZ53_00680) | - | 101925..102446 (-) | 522 | WP_003105760.1 | PepSY domain-containing protein | - |
| CGZ53_RS00685 (CGZ53_00685) | - | 103096..103545 (+) | 450 | WP_037593009.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| CGZ53_RS00690 (CGZ53_00690) | - | 103880..104197 (+) | 318 | WP_012657655.1 | hypothetical protein | - |
| CGZ53_RS00695 (CGZ53_00695) | - | 104371..105417 (+) | 1047 | WP_012657656.1 | zinc-binding dehydrogenase | - |
| CGZ53_RS00700 (CGZ53_00700) | - | 105628..106527 (+) | 900 | WP_012657657.1 | prenyltransferase | - |
| CGZ53_RS00705 (CGZ53_00705) | - | 106560..107771 (+) | 1212 | WP_100911833.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| CGZ53_RS00710 (CGZ53_00710) | - | 107853..109280 (+) | 1428 | WP_012657659.1 | cytochrome ubiquinol oxidase subunit I | - |
| CGZ53_RS00715 (CGZ53_00715) | cydB | 109280..110299 (+) | 1020 | WP_012657660.1 | cytochrome d ubiquinol oxidase subunit II | - |
| CGZ53_RS00720 (CGZ53_00720) | cydD | 110299..112017 (+) | 1719 | WP_012657661.1 | thiol reductant ABC exporter subunit CydD | - |
| CGZ53_RS00725 (CGZ53_00725) | cydC | 112010..113755 (+) | 1746 | WP_100911834.1 | thiol reductant ABC exporter subunit CydC | - |
| CGZ53_RS00730 (CGZ53_00730) | - | 113787..114767 (-) | 981 | WP_012657663.1 | polyprenyl synthetase family protein | - |
| CGZ53_RS00735 (CGZ53_00735) | ispE | 114974..115825 (+) | 852 | WP_012657664.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| CGZ53_RS00740 (CGZ53_00740) | - | 115886..116329 (+) | 444 | WP_012657665.1 | zinc-dependent MarR family transcriptional regulator | - |
| CGZ53_RS00745 (CGZ53_00745) | - | 116334..117035 (+) | 702 | WP_012657666.1 | metal ABC transporter ATP-binding protein | - |
| CGZ53_RS00750 (CGZ53_00750) | - | 117035..117850 (+) | 816 | WP_012657667.1 | metal ABC transporter permease | - |
| CGZ53_RS00755 (CGZ53_00755) | tyrS | 117910..119166 (-) | 1257 | WP_100911835.1 | tyrosine--tRNA ligase | - |
| CGZ53_RS00760 (CGZ53_00760) | pbp1b | 119258..121576 (+) | 2319 | WP_100911836.1 | penicillin-binding protein PBP1B | - |
| CGZ53_RS00765 (CGZ53_00765) | rpoB | 121840..125406 (+) | 3567 | WP_046389806.1 | DNA-directed RNA polymerase subunit beta | - |
| CGZ53_RS00770 (CGZ53_00770) | rpoC | 125498..129136 (+) | 3639 | WP_012657671.1 | DNA-directed RNA polymerase subunit beta' | - |
| CGZ53_RS00775 (CGZ53_00775) | - | 129257..129622 (+) | 366 | WP_100911837.1 | DUF1033 family protein | - |
| CGZ53_RS00780 (CGZ53_00780) | comGA/cglA | 129695..130636 (+) | 942 | WP_012657673.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| CGZ53_RS00785 (CGZ53_00785) | comYB | 130569..131603 (+) | 1035 | WP_398583501.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| CGZ53_RS00790 (CGZ53_00790) | comGC/cglC | 131604..131927 (+) | 324 | WP_012657675.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| CGZ53_RS00795 (CGZ53_00795) | comGD | 131881..132318 (+) | 438 | WP_012657676.1 | competence type IV pilus minor pilin ComGD | - |
| CGZ53_RS00800 (CGZ53_00800) | comGE | 132359..132589 (+) | 231 | WP_230081134.1 | competence type IV pilus minor pilin ComGE | - |
| CGZ53_RS00805 (CGZ53_00805) | comGF | 132549..133004 (+) | 456 | WP_012657678.1 | competence type IV pilus minor pilin ComGF | - |
| CGZ53_RS00810 (CGZ53_00810) | comGG | 132982..133341 (+) | 360 | WP_037592916.1 | competence type IV pilus minor pilin ComGG | - |
| CGZ53_RS00815 (CGZ53_00815) | comYH | 133386..134342 (+) | 957 | WP_046389809.1 | class I SAM-dependent methyltransferase | Machinery gene |
| CGZ53_RS00820 (CGZ53_00820) | - | 134398..135588 (+) | 1191 | WP_012657681.1 | acetate kinase | - |
| CGZ53_RS00825 (CGZ53_00825) | - | 135706..135909 (+) | 204 | WP_012657682.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 107 a.a. Molecular weight: 12304.58 Da Isoelectric Point: 9.9864
>NTDB_id=239364 CGZ53_RS00790 WP_012657675.1 131604..131927(+) (comGC/cglC) [Streptococcus uberis strain NZ01]
MKKWMKTLENKKAKAFTLLEMLMVLLIISVLMLLFIPNLSKQKEKVTDKGNAAVVKIVENQAELYELNEGKKPNLSELVQ
NGNITKKQVEAYNDYYQKHPGENKLLP
MKKWMKTLENKKAKAFTLLEMLMVLLIISVLMLLFIPNLSKQKEKVTDKGNAAVVKIVENQAELYELNEGKKPNLSELVQ
NGNITKKQVEAYNDYYQKHPGENKLLP
Nucleotide
Download Length: 324 bp
>NTDB_id=239364 CGZ53_RS00790 WP_012657675.1 131604..131927(+) (comGC/cglC) [Streptococcus uberis strain NZ01]
ATGAAAAAATGGATGAAAACTTTAGAAAACAAGAAGGCAAAAGCTTTCACACTTTTAGAAATGCTAATGGTCCTTCTGAT
CATCAGCGTGCTCATGCTTTTATTTATTCCCAATTTAAGCAAGCAAAAAGAAAAGGTAACCGATAAAGGAAATGCTGCAG
TTGTGAAAATTGTAGAAAATCAAGCAGAGCTCTATGAATTGAATGAAGGGAAAAAACCTAATTTAAGTGAGTTAGTACAA
AATGGTAATATCACTAAAAAACAAGTAGAGGCATATAATGACTATTATCAAAAACATCCTGGTGAAAATAAGCTGTTGCC
ATAG
ATGAAAAAATGGATGAAAACTTTAGAAAACAAGAAGGCAAAAGCTTTCACACTTTTAGAAATGCTAATGGTCCTTCTGAT
CATCAGCGTGCTCATGCTTTTATTTATTCCCAATTTAAGCAAGCAAAAAGAAAAGGTAACCGATAAAGGAAATGCTGCAG
TTGTGAAAATTGTAGAAAATCAAGCAGAGCTCTATGAATTGAATGAAGGGAAAAAACCTAATTTAAGTGAGTTAGTACAA
AATGGTAATATCACTAAAAAACAAGTAGAGGCATATAATGACTATTATCAAAAACATCCTGGTGAAAATAAGCTGTTGCC
ATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus mitis SK321 |
61.538 |
97.196 |
0.598 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
62.376 |
94.393 |
0.589 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
58.654 |
97.196 |
0.57 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
58.654 |
97.196 |
0.57 |
| comGC/cglC | Streptococcus pneumoniae D39 |
58.654 |
97.196 |
0.57 |
| comGC/cglC | Streptococcus pneumoniae R6 |
58.654 |
97.196 |
0.57 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
60.606 |
92.523 |
0.561 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
59 |
93.458 |
0.551 |
| comYC | Streptococcus mutans UA140 |
58 |
93.458 |
0.542 |
| comYC | Streptococcus mutans UA159 |
58 |
93.458 |
0.542 |
| comYC | Streptococcus suis isolate S10 |
54.545 |
82.243 |
0.449 |