Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | B2G65_RS05480 | Genome accession | NZ_CP022354 |
| Coordinates | 1037408..1037590 (-) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain GUR | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1037408..1075597 | 1037408..1037590 | within | 0 |
Gene organization within MGE regions
Location: 1037408..1075597
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B2G65_RS05480 (B2G65_05480) | prx | 1037408..1037590 (-) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
| B2G65_RS05485 (B2G65_05485) | - | 1037789..1037998 (-) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| B2G65_RS10010 | - | 1038152..1038298 (+) | 147 | WP_011054449.1 | hypothetical protein | - |
| B2G65_RS05490 (B2G65_05490) | - | 1038439..1038690 (+) | 252 | WP_011054448.1 | hypothetical protein | - |
| B2G65_RS05495 (B2G65_05495) | - | 1038954..1039193 (+) | 240 | WP_011054447.1 | hypothetical protein | - |
| B2G65_RS05500 (B2G65_05500) | - | 1039251..1039607 (+) | 357 | WP_011054446.1 | hypothetical protein | - |
| B2G65_RS05505 (B2G65_05505) | - | 1039723..1040928 (-) | 1206 | WP_029714018.1 | glucosaminidase domain-containing protein | - |
| B2G65_RS05510 (B2G65_05510) | - | 1041051..1041278 (-) | 228 | WP_029714020.1 | phage holin | - |
| B2G65_RS05515 (B2G65_05515) | - | 1041275..1041547 (-) | 273 | WP_093974706.1 | hypothetical protein | - |
| B2G65_RS05520 (B2G65_05520) | - | 1041559..1042197 (-) | 639 | WP_046735270.1 | hypothetical protein | - |
| B2G65_RS05525 (B2G65_05525) | - | 1042200..1042628 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| B2G65_RS05530 (B2G65_05530) | - | 1042640..1044544 (-) | 1905 | WP_011017395.1 | gp58-like family protein | - |
| B2G65_RS05535 (B2G65_05535) | - | 1044554..1045560 (-) | 1007 | Protein_1030 | hyaluronoglucosaminidase | - |
| B2G65_RS05540 (B2G65_05540) | - | 1045557..1047608 (-) | 2052 | WP_011054440.1 | phage tail spike protein | - |
| B2G65_RS05545 (B2G65_05545) | - | 1047605..1048375 (-) | 771 | WP_029713951.1 | distal tail protein Dit | - |
| B2G65_RS05550 (B2G65_05550) | - | 1048388..1052488 (-) | 4101 | WP_093974708.1 | phage tail tape measure protein | - |
| B2G65_RS05555 (B2G65_05555) | gpG | 1052713..1053015 (-) | 303 | WP_029713954.1 | phage tail assembly chaperone G | - |
| B2G65_RS05560 (B2G65_05560) | - | 1053111..1053695 (-) | 585 | WP_029713955.1 | major tail protein | - |
| B2G65_RS05565 (B2G65_05565) | - | 1053707..1054087 (-) | 381 | WP_029713956.1 | hypothetical protein | - |
| B2G65_RS05570 (B2G65_05570) | - | 1054080..1054478 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| B2G65_RS05575 (B2G65_05575) | - | 1054480..1054842 (-) | 363 | WP_029713957.1 | hypothetical protein | - |
| B2G65_RS05580 (B2G65_05580) | - | 1054835..1055143 (-) | 309 | WP_029713958.1 | hypothetical protein | - |
| B2G65_RS10015 | - | 1055143..1055316 (-) | 174 | WP_164875336.1 | hypothetical protein | - |
| B2G65_RS05585 (B2G65_05585) | - | 1055327..1056460 (-) | 1134 | WP_093974710.1 | phage major capsid protein | - |
| B2G65_RS05590 (B2G65_05590) | - | 1056477..1057283 (-) | 807 | WP_029713960.1 | head maturation protease, ClpP-related | - |
| B2G65_RS05595 (B2G65_05595) | - | 1057264..1058451 (-) | 1188 | WP_027970293.1 | phage portal protein | - |
| B2G65_RS05600 (B2G65_05600) | - | 1058632..1060362 (-) | 1731 | WP_093974712.1 | terminase large subunit domain-containing protein | - |
| B2G65_RS05605 (B2G65_05605) | - | 1060375..1060692 (-) | 318 | WP_029713962.1 | P27 family phage terminase small subunit | - |
| B2G65_RS05610 (B2G65_05610) | - | 1060835..1061140 (-) | 306 | WP_186433262.1 | HNH endonuclease | - |
| B2G65_RS05615 (B2G65_05615) | - | 1061133..1061519 (-) | 387 | WP_093974962.1 | hypothetical protein | - |
| B2G65_RS05625 (B2G65_05625) | - | 1061761..1062006 (-) | 246 | WP_029713966.1 | hypothetical protein | - |
| B2G65_RS05630 (B2G65_05630) | - | 1062030..1062326 (-) | 297 | WP_029713967.1 | hypothetical protein | - |
| B2G65_RS05635 (B2G65_05635) | - | 1062481..1063056 (-) | 576 | WP_029713968.1 | site-specific integrase | - |
| B2G65_RS05640 (B2G65_05640) | - | 1063214..1063615 (-) | 402 | WP_027970299.1 | hypothetical protein | - |
| B2G65_RS05645 (B2G65_05645) | - | 1063618..1063962 (-) | 345 | WP_029713969.1 | helix-turn-helix domain-containing protein | - |
| B2G65_RS05650 (B2G65_05650) | - | 1063959..1064237 (-) | 279 | WP_029713970.1 | hypothetical protein | - |
| B2G65_RS05655 (B2G65_05655) | ssbA | 1064251..1064643 (-) | 393 | WP_029713971.1 | single-stranded DNA-binding protein | Machinery gene |
| B2G65_RS05660 (B2G65_05660) | - | 1064640..1064861 (-) | 222 | WP_003057301.1 | hypothetical protein | - |
| B2G65_RS05665 (B2G65_05665) | - | 1064854..1065186 (-) | 333 | WP_029713972.1 | hypothetical protein | - |
| B2G65_RS05670 (B2G65_05670) | - | 1065179..1065418 (-) | 240 | WP_029713973.1 | DUF3310 domain-containing protein | - |
| B2G65_RS05675 (B2G65_05675) | - | 1065541..1065846 (-) | 306 | WP_093974715.1 | DUF1372 family protein | - |
| B2G65_RS05680 (B2G65_05680) | - | 1065843..1066334 (-) | 492 | WP_093974717.1 | MazG-like family protein | - |
| B2G65_RS05685 (B2G65_05685) | - | 1066321..1066485 (-) | 165 | WP_153276856.1 | hypothetical protein | - |
| B2G65_RS05690 (B2G65_05690) | - | 1066496..1066726 (-) | 231 | WP_029713977.1 | hypothetical protein | - |
| B2G65_RS05695 (B2G65_05695) | - | 1066726..1067547 (-) | 822 | WP_029713978.1 | ATP-binding protein | - |
| B2G65_RS05700 (B2G65_05700) | - | 1067548..1068294 (-) | 747 | WP_029713979.1 | conserved phage C-terminal domain-containing protein | - |
| B2G65_RS05705 (B2G65_05705) | dnaB | 1068281..1069627 (-) | 1347 | WP_029713980.1 | replicative DNA helicase | - |
| B2G65_RS05710 (B2G65_05710) | - | 1069614..1069802 (-) | 189 | WP_029713981.1 | hypothetical protein | - |
| B2G65_RS05715 (B2G65_05715) | - | 1069957..1070214 (-) | 258 | WP_022554795.1 | hypothetical protein | - |
| B2G65_RS10150 | - | 1070287..1070388 (-) | 102 | Protein_1067 | XRE family transcriptional regulator | - |
| B2G65_RS05720 (B2G65_05720) | - | 1070471..1070677 (+) | 207 | WP_029713982.1 | hypothetical protein | - |
| B2G65_RS05725 (B2G65_05725) | - | 1070674..1070886 (-) | 213 | WP_029713983.1 | hypothetical protein | - |
| B2G65_RS05730 (B2G65_05730) | - | 1070961..1071680 (-) | 720 | WP_029713984.1 | ORF6C domain-containing protein | - |
| B2G65_RS05735 (B2G65_05735) | - | 1071723..1071950 (-) | 228 | WP_029713985.1 | hypothetical protein | - |
| B2G65_RS05740 (B2G65_05740) | - | 1072189..1072770 (-) | 582 | WP_029713986.1 | hypothetical protein | - |
| B2G65_RS10020 (B2G65_05745) | - | 1072945..1073091 (-) | 147 | WP_022554802.1 | hypothetical protein | - |
| B2G65_RS05750 (B2G65_05750) | - | 1073250..1074005 (+) | 756 | WP_093974719.1 | helix-turn-helix domain-containing protein | - |
| B2G65_RS05755 (B2G65_05755) | - | 1074401..1075597 (+) | 1197 | WP_029713988.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=238692 B2G65_RS05480 WP_029714017.1 1037408..1037590(-) (prx) [Streptococcus pyogenes strain GUR]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=238692 B2G65_RS05480 WP_029714017.1 1037408..1037590(-) (prx) [Streptococcus pyogenes strain GUR]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |