Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M6_RS07735 | Genome accession | NC_006086 |
| Coordinates | 1543719..1543901 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS10394 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1543719..1592795 | 1543719..1543901 | within | 0 |
Gene organization within MGE regions
Location: 1543719..1592795
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6_RS07735 (M6_Spy1540) | prx | 1543719..1543901 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| M6_RS07740 (M6_Spy1541) | - | 1544139..1544939 (+) | 801 | WP_021340119.1 | DNA/RNA non-specific endonuclease | - |
| M6_RS07745 (M6_Spy1542) | - | 1545001..1545201 (-) | 201 | WP_003058228.1 | CsbD family protein | - |
| M6_RS07750 (M6_Spy1543) | - | 1545386..1546357 (-) | 972 | WP_011888780.1 | Abi family protein | - |
| M6_RS07755 (M6_Spy1544) | - | 1546648..1547400 (-) | 753 | WP_011184910.1 | CHAP domain-containing protein | - |
| M6_RS07760 (M6_Spy1545) | - | 1547522..1547749 (-) | 228 | WP_000609113.1 | phage holin | - |
| M6_RS07765 (M6_Spy1546) | - | 1547746..1548018 (-) | 273 | WP_002986916.1 | DUF7365 family protein | - |
| M6_RS07770 (M6_Spy1547) | - | 1548028..1548645 (-) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| M6_RS07775 (M6_Spy1548) | - | 1548642..1549079 (-) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| M6_RS07780 (M6_Spy1549) | - | 1549091..1551106 (-) | 2016 | WP_011184911.1 | gp58-like family protein | - |
| M6_RS07785 (M6_Spy1550) | hylP | 1551119..1552144 (-) | 1026 | WP_011184912.1 | hyaluronidase HylP | - |
| M6_RS07790 (M6_Spy1551) | - | 1552141..1554192 (-) | 2052 | WP_011184913.1 | phage tail spike protein | - |
| M6_RS07795 (M6_Spy1552) | - | 1554189..1554968 (-) | 780 | WP_011184914.1 | distal tail protein Dit | - |
| M6_RS07800 (M6_Spy1553) | - | 1555000..1558635 (-) | 3636 | WP_011184915.1 | tape measure protein | - |
| M6_RS07805 (M6_Spy1554) | - | 1558650..1558979 (-) | 330 | WP_002988428.1 | hypothetical protein | - |
| M6_RS07810 (M6_Spy1555) | - | 1559021..1559380 (-) | 360 | WP_011184916.1 | tail assembly chaperone | - |
| M6_RS07815 (M6_Spy1556) | - | 1559432..1560025 (-) | 594 | WP_011184917.1 | phage major tail protein, TP901-1 family | - |
| M6_RS07820 (M6_Spy1557) | - | 1560096..1560281 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| M6_RS10465 (M6_Spy1558) | - | 1560285..1560890 (-) | 606 | WP_011184918.1 | ADP-ribosyltransferase | - |
| M6_RS10470 (M6_Spy1559) | - | 1560835..1561848 (-) | 1014 | WP_011184919.1 | phage head morphogenesis protein | - |
| M6_RS07835 (M6_Spy1560) | - | 1561829..1563331 (-) | 1503 | WP_011184920.1 | phage portal protein | - |
| M6_RS07840 (M6_Spy1561) | - | 1563343..1564110 (-) | 768 | Protein_1522 | PBSX family phage terminase large subunit | - |
| M6_RS07845 (M6_Spy1562) | - | 1564282..1564566 (+) | 285 | Protein_1523 | tyrosine-type recombinase/integrase | - |
| M6_RS07850 (M6_Spy1563) | - | 1564810..1565754 (+) | 945 | WP_002983147.1 | magnesium transporter CorA family protein | - |
| M6_RS07855 (M6_Spy1564) | - | 1565886..1566542 (+) | 657 | WP_002983144.1 | DUF1129 domain-containing protein | - |
| M6_RS07860 (M6_Spy1565) | rpsR | 1566675..1566914 (-) | 240 | WP_002983142.1 | 30S ribosomal protein S18 | - |
| M6_RS07865 (M6_Spy1566) | ssb | 1567079..1567570 (-) | 492 | WP_002983122.1 | single-stranded DNA-binding protein | Machinery gene |
| M6_RS07870 (M6_Spy1567) | rpsF | 1567592..1567882 (-) | 291 | WP_002983117.1 | 30S ribosomal protein S6 | - |
| M6_RS07875 (M6_Spy1568) | - | 1568055..1568348 (-) | 294 | WP_002983113.1 | hypothetical protein | - |
| M6_RS07880 (M6_Spy1569) | mutY | 1568516..1569670 (+) | 1155 | WP_002988276.1 | A/G-specific adenine glycosylase | - |
| M6_RS07885 (M6_Spy1570) | - | 1569835..1570359 (+) | 525 | Protein_1531 | helix-turn-helix domain-containing protein | - |
| M6_RS07890 (M6_Spy1571) | trxA | 1570411..1570743 (-) | 333 | WP_001932060.1 | thioredoxin | - |
| M6_RS07895 (M6_Spy1572) | - | 1570806..1571306 (-) | 501 | WP_021340636.1 | phosphatase PAP2 family protein | - |
| M6_RS07900 (M6_Spy1573) | - | 1571310..1573649 (-) | 2340 | WP_023078038.1 | endonuclease MutS2 | - |
| M6_RS07905 (M6_Spy1574) | - | 1573798..1574343 (-) | 546 | WP_011184926.1 | CvpA family protein | - |
| M6_RS07910 (M6_Spy1575) | - | 1574346..1574654 (-) | 309 | WP_002993251.1 | hypothetical protein | - |
| M6_RS07915 (M6_Spy1576) | rnhC | 1574811..1575713 (+) | 903 | WP_010922635.1 | ribonuclease HIII | - |
| M6_RS07920 (M6_Spy1577) | lepB | 1575724..1576317 (+) | 594 | WP_002983074.1 | signal peptidase I | - |
| M6_RS07925 (M6_Spy1578) | - | 1576375..1578828 (+) | 2454 | WP_011184928.1 | ATP-dependent RecD-like DNA helicase | - |
| M6_RS07930 (M6_Spy1579) | - | 1578919..1579401 (+) | 483 | WP_002983066.1 | hypothetical protein | - |
| M6_RS07935 (M6_Spy1580) | dinB | 1579494..1580588 (-) | 1095 | WP_002983063.1 | DNA polymerase IV | - |
| M6_RS07940 (M6_Spy1581) | pflB | 1580797..1583124 (+) | 2328 | WP_002988233.1 | formate C-acetyltransferase | - |
| M6_RS07945 (M6_Spy1582) | - | 1583304..1584254 (-) | 951 | WP_011018196.1 | serine hydrolase domain-containing protein | - |
| M6_RS07950 (M6_Spy1583) | - | 1584239..1584991 (-) | 753 | WP_011184930.1 | CppA N-terminal domain-containing protein | - |
| M6_RS07955 (M6_Spy1584) | - | 1585289..1586185 (+) | 897 | WP_002983050.1 | sulfite exporter TauE/SafE family protein | - |
| M6_RS07960 (M6_Spy1585) | gla | 1586521..1587369 (-) | 849 | WP_002983047.1 | aquaglyceroporin Gla | - |
| M6_RS07965 (M6_Spy1586) | - | 1587841..1589037 (-) | 1197 | WP_002993271.1 | MFS transporter | - |
| M6_RS07970 (M6_Spy1587) | - | 1589203..1589862 (+) | 660 | WP_021340637.1 | Crp/Fnr family transcriptional regulator | - |
| M6_RS07975 (M6_Spy1588) | - | 1589884..1592166 (+) | 2283 | WP_011184932.1 | Xaa-Pro dipeptidyl-peptidase | - |
| M6_RS07980 (M6_Spy1589) | - | 1592246..1592467 (-) | 222 | WP_002988211.1 | helix-turn-helix domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=23468 M6_RS07735 WP_011184907.1 1543719..1543901(-) (prx) [Streptococcus pyogenes MGAS10394]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=23468 M6_RS07735 WP_011184907.1 1543719..1543901(-) (prx) [Streptococcus pyogenes MGAS10394]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |