Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   SPS_RS03535 Genome accession   NC_004606
Coordinates   666399..666581 (+) Length   60 a.a.
NCBI ID   WP_011054726.1    Uniprot ID   A0A5S4TS04
Organism   Streptococcus pyogenes SSI-1     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 625070..666581 666399..666581 within 0


Gene organization within MGE regions


Location: 625070..666581
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPS_RS03235 (SPs0597) - 625070..626167 (-) 1098 WP_015967409.1 site-specific integrase -
  SPS_RS03240 - 626343..626864 (-) 522 WP_002986895.1 hypothetical protein -
  SPS_RS03245 (SPs0599) - 626875..627255 (-) 381 WP_002986894.1 ImmA/IrrE family metallo-endopeptidase -
  SPS_RS03250 (SPs0600) - 627269..627622 (-) 354 WP_002986893.1 helix-turn-helix domain-containing protein -
  SPS_RS03255 (SPs0601) - 628424..628615 (+) 192 WP_002986891.1 hypothetical protein -
  SPS_RS03260 (SPs0602) - 628626..629354 (+) 729 WP_011054767.1 phage antirepressor KilAC domain-containing protein -
  SPS_RS10265 - 629387..629536 (+) 150 WP_002986888.1 hypothetical protein -
  SPS_RS03265 (SPs0604) - 629533..629733 (-) 201 WP_002986887.1 KTSC domain-containing protein -
  SPS_RS09795 - 629809..629976 (+) 168 WP_002986885.1 hypothetical protein -
  SPS_RS03275 (SPs0606) - 630222..630479 (+) 258 WP_002988339.1 hypothetical protein -
  SPS_RS03280 (SPs0607) - 630508..630693 (+) 186 WP_011054765.1 hypothetical protein -
  SPS_RS09800 - 630787..631044 (+) 258 WP_011106684.1 hypothetical protein -
  SPS_RS03285 (SPs0609) - 631166..631579 (+) 414 WP_011054763.1 DnaD domain protein -
  SPS_RS03290 (SPs0610) - 631560..631793 (+) 234 WP_011054762.1 hypothetical protein -
  SPS_RS10270 - 631790..631930 (+) 141 WP_011284979.1 hypothetical protein -
  SPS_RS03295 (SPs0611) - 631941..632195 (+) 255 WP_011054761.1 hypothetical protein -
  SPS_RS03300 (SPs0612) - 632217..632699 (+) 483 WP_011018142.1 siphovirus Gp157 family protein -
  SPS_RS03305 (SPs0613) - 632700..633374 (+) 675 WP_011054760.1 ERF family protein -
  SPS_RS03310 (SPs0614) ssbA 633367..633786 (+) 420 WP_011054759.1 single-stranded DNA-binding protein Machinery gene
  SPS_RS03315 (SPs0615) - 633792..633995 (+) 204 WP_011106686.1 hypothetical protein -
  SPS_RS03320 - 633995..634435 (+) 441 WP_011054758.1 RusA family crossover junction endodeoxyribonuclease -
  SPS_RS03325 (SPs0617) - 634432..634788 (+) 357 WP_011054757.1 hypothetical protein -
  SPS_RS03330 (SPs0618) - 634785..635036 (+) 252 WP_011054756.1 hypothetical protein -
  SPS_RS03335 (SPs0619) - 635030..635314 (+) 285 WP_011054755.1 DUF3310 domain-containing protein -
  SPS_RS03340 - 635311..635580 (+) 270 WP_011054754.1 hypothetical protein -
  SPS_RS03345 (SPs0621) - 635590..635994 (+) 405 WP_011054753.1 YopX family protein -
  SPS_RS10275 - 635991..636161 (+) 171 WP_011054752.1 hypothetical protein -
  SPS_RS03350 (SPs0623) - 636158..636664 (+) 507 WP_011054751.1 DUF1642 domain-containing protein -
  SPS_RS10280 - 636661..636831 (+) 171 WP_164997036.1 hypothetical protein -
  SPS_RS03355 (SPs0624) - 637105..637545 (+) 441 WP_011017866.1 ArpU family phage packaging/lysis transcriptional regulator -
  SPS_RS09820 - 638184..638441 (-) 258 WP_011054748.1 hypothetical protein -
  SPS_RS03360 (SPs0625) - 638522..639040 (+) 519 WP_002986854.1 ParB N-terminal domain-containing protein -
  SPS_RS03365 (SPs0626) - 639019..639696 (+) 678 WP_002986850.1 ABC transporter ATP-binding protein -
  SPS_RS10370 - 639705..640088 (+) 384 WP_076639321.1 GNAT family N-acetyltransferase -
  SPS_RS03375 (SPs0628) - 640149..640526 (+) 378 WP_002986841.1 ASCH domain-containing protein -
  SPS_RS03380 (SPs0629) - 640568..641050 (+) 483 WP_015967410.1 hypothetical protein -
  SPS_RS03385 (SPs0630) - 641133..642344 (+) 1212 WP_010922074.1 PBSX family phage terminase large subunit -
  SPS_RS03390 (SPs0631) - 642358..643860 (+) 1503 WP_002986832.1 phage portal protein -
  SPS_RS03395 (SPs0632) - 643865..645343 (+) 1479 WP_011054746.1 phage minor capsid protein -
  SPS_RS03400 (SPs0633) - 645315..645554 (+) 240 WP_002986829.1 hypothetical protein -
  SPS_RS03405 (SPs0634) - 645616..645882 (+) 267 WP_011054745.1 hypothetical protein -
  SPS_RS03410 (SPs0635) - 646008..646622 (+) 615 WP_011106689.1 hypothetical protein -
  SPS_RS03415 (SPs0636) - 646626..647444 (+) 819 WP_010922080.1 N4-gp56 family major capsid protein -
  SPS_RS03420 (SPs0637) - 647498..647914 (+) 417 WP_011054743.1 hypothetical protein -
  SPS_RS03425 (SPs0638) - 647904..648236 (+) 333 WP_010922082.1 minor capsid protein -
  SPS_RS03430 (SPs0639) - 648236..648592 (+) 357 WP_010922083.1 minor capsid protein -
  SPS_RS03435 (SPs0640) - 648589..648987 (+) 399 WP_010922084.1 minor capsid protein -
  SPS_RS03440 (SPs0641) - 648987..649472 (+) 486 WP_011054741.1 phage tail tube protein -
  SPS_RS03445 (SPs0642) - 649511..649945 (+) 435 WP_011054740.1 hypothetical protein -
  SPS_RS03450 (SPs0643) - 649949..650530 (+) 582 WP_011054739.1 bacteriophage Gp15 family protein -
  SPS_RS03455 (SPs0644) - 650520..653780 (+) 3261 WP_011054738.1 tape measure protein -
  SPS_RS03460 (SPs0645) - 653777..654493 (+) 717 WP_011054737.1 distal tail protein Dit -
  SPS_RS03465 - 654490..656634 (+) 2145 WP_011054736.1 phage tail spike protein -
  SPS_RS03470 (SPs0648) hylP 656631..657644 (+) 1014 WP_011054735.1 hyaluronidase HylP -
  SPS_RS03475 (SPs0649) - 657659..659542 (+) 1884 WP_011054734.1 gp58-like family protein -
  SPS_RS03480 (SPs0650) - 659554..659985 (+) 432 WP_002987513.1 DUF1617 family protein -
  SPS_RS03485 - 659988..660599 (+) 612 WP_011054733.1 DUF1366 domain-containing protein -
  SPS_RS03490 (SPs0652) - 660610..660906 (+) 297 WP_011054732.1 hypothetical protein -
  SPS_RS03495 (SPs0653) - 660903..661088 (+) 186 WP_011054731.1 holin -
  SPS_RS03505 (SPs0654) - 661199..662401 (+) 1203 WP_011054730.1 glucosaminidase domain-containing protein -
  SPS_RS03510 (SPs0655) - 662541..663065 (+) 525 WP_011017840.1 Panacea domain-containing protein -
  SPS_RS03515 (SPs0656) - 663053..663919 (+) 867 WP_011054729.1 DUF334 domain-containing protein -
  SPS_RS03520 (SPs0657) spek 664223..665002 (+) 780 WP_041174277.1 streptococcal pyrogenic exotoxin SpeK -
  SPS_RS03525 (SPs0658) - 665478..666053 (+) 576 WP_011054727.1 hypothetical protein -
  SPS_RS03535 prx 666399..666581 (+) 183 WP_011054726.1 hypothetical protein Regulator

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6771.70 Da        Isoelectric Point: 3.9944

>NTDB_id=22801 SPS_RS03535 WP_011054726.1 666399..666581(+) (prx) [Streptococcus pyogenes SSI-1]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=22801 SPS_RS03535 WP_011054726.1 666399..666581(+) (prx) [Streptococcus pyogenes SSI-1]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5S4TS04

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

100

100

1

  prx Streptococcus pyogenes MGAS8232

80

100

0.8

  prx Streptococcus pyogenes MGAS315

80

100

0.8

  prx Streptococcus pyogenes MGAS315

80

100

0.8

  prx Streptococcus pyogenes MGAS315

78.333

100

0.783

  prx Streptococcus pyogenes MGAS315

73.333

100

0.733

  prx Streptococcus pyogenes MGAS315

87.805

68.333

0.6


Multiple sequence alignment