Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPS_RS03535 | Genome accession | NC_004606 |
| Coordinates | 666399..666581 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes SSI-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 625070..666581 | 666399..666581 | within | 0 |
Gene organization within MGE regions
Location: 625070..666581
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPS_RS03235 (SPs0597) | - | 625070..626167 (-) | 1098 | WP_015967409.1 | site-specific integrase | - |
| SPS_RS03240 | - | 626343..626864 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| SPS_RS03245 (SPs0599) | - | 626875..627255 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPS_RS03250 (SPs0600) | - | 627269..627622 (-) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS03255 (SPs0601) | - | 628424..628615 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| SPS_RS03260 (SPs0602) | - | 628626..629354 (+) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| SPS_RS10265 | - | 629387..629536 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| SPS_RS03265 (SPs0604) | - | 629533..629733 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| SPS_RS09795 | - | 629809..629976 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| SPS_RS03275 (SPs0606) | - | 630222..630479 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| SPS_RS03280 (SPs0607) | - | 630508..630693 (+) | 186 | WP_011054765.1 | hypothetical protein | - |
| SPS_RS09800 | - | 630787..631044 (+) | 258 | WP_011106684.1 | hypothetical protein | - |
| SPS_RS03285 (SPs0609) | - | 631166..631579 (+) | 414 | WP_011054763.1 | DnaD domain protein | - |
| SPS_RS03290 (SPs0610) | - | 631560..631793 (+) | 234 | WP_011054762.1 | hypothetical protein | - |
| SPS_RS10270 | - | 631790..631930 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| SPS_RS03295 (SPs0611) | - | 631941..632195 (+) | 255 | WP_011054761.1 | hypothetical protein | - |
| SPS_RS03300 (SPs0612) | - | 632217..632699 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPS_RS03305 (SPs0613) | - | 632700..633374 (+) | 675 | WP_011054760.1 | ERF family protein | - |
| SPS_RS03310 (SPs0614) | ssbA | 633367..633786 (+) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| SPS_RS03315 (SPs0615) | - | 633792..633995 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPS_RS03320 | - | 633995..634435 (+) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPS_RS03325 (SPs0617) | - | 634432..634788 (+) | 357 | WP_011054757.1 | hypothetical protein | - |
| SPS_RS03330 (SPs0618) | - | 634785..635036 (+) | 252 | WP_011054756.1 | hypothetical protein | - |
| SPS_RS03335 (SPs0619) | - | 635030..635314 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| SPS_RS03340 | - | 635311..635580 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| SPS_RS03345 (SPs0621) | - | 635590..635994 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| SPS_RS10275 | - | 635991..636161 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| SPS_RS03350 (SPs0623) | - | 636158..636664 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| SPS_RS10280 | - | 636661..636831 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| SPS_RS03355 (SPs0624) | - | 637105..637545 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPS_RS09820 | - | 638184..638441 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| SPS_RS03360 (SPs0625) | - | 638522..639040 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| SPS_RS03365 (SPs0626) | - | 639019..639696 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| SPS_RS10370 | - | 639705..640088 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| SPS_RS03375 (SPs0628) | - | 640149..640526 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| SPS_RS03380 (SPs0629) | - | 640568..641050 (+) | 483 | WP_015967410.1 | hypothetical protein | - |
| SPS_RS03385 (SPs0630) | - | 641133..642344 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| SPS_RS03390 (SPs0631) | - | 642358..643860 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| SPS_RS03395 (SPs0632) | - | 643865..645343 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| SPS_RS03400 (SPs0633) | - | 645315..645554 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| SPS_RS03405 (SPs0634) | - | 645616..645882 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| SPS_RS03410 (SPs0635) | - | 646008..646622 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| SPS_RS03415 (SPs0636) | - | 646626..647444 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SPS_RS03420 (SPs0637) | - | 647498..647914 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| SPS_RS03425 (SPs0638) | - | 647904..648236 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| SPS_RS03430 (SPs0639) | - | 648236..648592 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPS_RS03435 (SPs0640) | - | 648589..648987 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| SPS_RS03440 (SPs0641) | - | 648987..649472 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| SPS_RS03445 (SPs0642) | - | 649511..649945 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| SPS_RS03450 (SPs0643) | - | 649949..650530 (+) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| SPS_RS03455 (SPs0644) | - | 650520..653780 (+) | 3261 | WP_011054738.1 | tape measure protein | - |
| SPS_RS03460 (SPs0645) | - | 653777..654493 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| SPS_RS03465 | - | 654490..656634 (+) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| SPS_RS03470 (SPs0648) | hylP | 656631..657644 (+) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| SPS_RS03475 (SPs0649) | - | 657659..659542 (+) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| SPS_RS03480 (SPs0650) | - | 659554..659985 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| SPS_RS03485 | - | 659988..660599 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| SPS_RS03490 (SPs0652) | - | 660610..660906 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| SPS_RS03495 (SPs0653) | - | 660903..661088 (+) | 186 | WP_011054731.1 | holin | - |
| SPS_RS03505 (SPs0654) | - | 661199..662401 (+) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| SPS_RS03510 (SPs0655) | - | 662541..663065 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| SPS_RS03515 (SPs0656) | - | 663053..663919 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| SPS_RS03520 (SPs0657) | spek | 664223..665002 (+) | 780 | WP_041174277.1 | streptococcal pyrogenic exotoxin SpeK | - |
| SPS_RS03525 (SPs0658) | - | 665478..666053 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| SPS_RS03535 | prx | 666399..666581 (+) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=22801 SPS_RS03535 WP_011054726.1 666399..666581(+) (prx) [Streptococcus pyogenes SSI-1]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=22801 SPS_RS03535 WP_011054726.1 666399..666581(+) (prx) [Streptococcus pyogenes SSI-1]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |