Detailed information NTG0020102

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: SSU05_1551
• Genome accession: CP000407
• Coordinates: 1480707..1480880 (-)
• Length: 57 a.a.
• NCBI ID: ABP90517.1
• Uniprot ID: -
• Organism: Streptococcus suis 05ZYH33
• Function: degradation of ComX; require for competence development (at the early growth phase); repress competence development (at the mid-logarithmic growth phase) (predicted from homology) Competence regulation

Genomic Context

Location: 1475707..1485880

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SSU05_1544	-	1475766..1476437 (-)	672	ABP90510.1	ABC-type branched-chain amino acid transport system, ATPase component	-
SSU05_1545	-	1476406..1476531 (-)	126	ABP90511.1	ABC-type branched-chain amino acid transport system, ATPase component	-
SSU05_1546	-	1476531..1477478 (-)	948	ABP90512.1	ABC-type branched-chain amino acid transport system, permease component	-
SSU05_1547	-	1477481..1478368 (-)	888	ABP90513.1	Branched-chain amino acid ABC-type transport system, permease component	-
SSU05_1548	-	1478584..1479753 (-)	1170	ABP90514.1	unknown protein	-
SSU05_1549	-	1479884..1480156 (-)	273	ABP90515.1	conserved hypothetical protein	-
SSU05_1550	clpP	1480431..1480586 (-)	156	ABP90516.1	ATP-dependent CLP protease proteolytic subunit	Regulator
SSU05_1551	clpP	1480707..1480880 (-)	174	ABP90517.1	putative ATP-dependent Clp protease, proteolytic subunit	Regulator
SSU05_1553	-	1480996..1481625 (-)	630	ABP90518.1	Uracil phosphoribosyltransferase	-
SSU05_1552	-	1481611..1481715 (+)	105	ABP90519.1	hypothetical protein	-
SSU05_1554	-	1481705..1483321 (-)	1617	ABP90520.1	Glycosidase	-
SSU05_1555	-	1483394..1484842 (-)	1449	ABP90521.1	Glycosidase	-
SSU05_1556	-	1484913..1485764 (-)	852	ABP90522.1	ABC-type sugar transport system, permease component	-

Sequence

Protein

• Length: 57 a.a.
• Molecular weight: 6523.63 Da
• Isoelectric Point: 6.1902

>NTDB_id=20102 SSU05_1551 ABP90517.1 1480707..1480880(-) (clpP) [Streptococcus suis 05ZYH33]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAPRPYAK

Nucleotide

• Length: 174 bp

>NTDB_id=20102 SSU05_1551 ABP90517.1 1480707..1480880(-) (clpP) [Streptococcus suis 05ZYH33]
ATGATTCCAGTAGTTATTGAACAAACTAGCCGTGGTGAGCGTTCTTATGATATTTACTCACGCCTTTTGAAAGACCGTAT
TATCATGTTGACAGGACCAGTTGAGGACAACATGGCAAACTCTATCATTGCACAATTGCTTTTCCTTGATGCTCCAAGAC
CCTATGCAAAGTGA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (10-53)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Streptococcus mutans UA159	100	89.474	0.895
clpP	Streptococcus pneumoniae D39	98.039	89.474	0.877
clpP	Streptococcus pneumoniae R6	98.039	89.474	0.877
clpP	Streptococcus pneumoniae TIGR4	98.039	89.474	0.877
clpP	Streptococcus pyogenes JRS4	98.039	89.474	0.877
clpP	Streptococcus pyogenes MGAS315	98.039	89.474	0.877
clpP	Streptococcus thermophilus LMG 18311	98.039	89.474	0.877
clpP	Streptococcus thermophilus LMD-9	98.039	89.474	0.877
clpP	Streptococcus pneumoniae Rx1	98.039	89.474	0.877
clpP	Lactococcus lactis subsp. cremoris KW2	88.235	89.474	0.789
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	88.235	89.474	0.789
clpP	Bacillus subtilis subsp. subtilis str. 168	72.222	94.737	0.684
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	72.222	94.737	0.684