Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | SSU05_1550 | Genome accession | CP000407 |
| Coordinates | 1480431..1480586 (-) | Length | 51 a.a. |
| NCBI ID | ABP90516.1 | Uniprot ID | - |
| Organism | Streptococcus suis 05ZYH33 | ||
| Function | degradation of ComX; degradation of ComW (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1475431..1485586
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSU05_1544 | - | 1475766..1476437 (-) | 672 | ABP90510.1 | ABC-type branched-chain amino acid transport system, ATPase component | - |
| SSU05_1545 | - | 1476406..1476531 (-) | 126 | ABP90511.1 | ABC-type branched-chain amino acid transport system, ATPase component | - |
| SSU05_1546 | - | 1476531..1477478 (-) | 948 | ABP90512.1 | ABC-type branched-chain amino acid transport system, permease component | - |
| SSU05_1547 | - | 1477481..1478368 (-) | 888 | ABP90513.1 | Branched-chain amino acid ABC-type transport system, permease component | - |
| SSU05_1548 | - | 1478584..1479753 (-) | 1170 | ABP90514.1 | unknown protein | - |
| SSU05_1549 | - | 1479884..1480156 (-) | 273 | ABP90515.1 | conserved hypothetical protein | - |
| SSU05_1550 | clpP | 1480431..1480586 (-) | 156 | ABP90516.1 | ATP-dependent CLP protease proteolytic subunit | Regulator |
| SSU05_1551 | clpP | 1480707..1480880 (-) | 174 | ABP90517.1 | putative ATP-dependent Clp protease, proteolytic subunit | Regulator |
| SSU05_1553 | - | 1480996..1481625 (-) | 630 | ABP90518.1 | Uracil phosphoribosyltransferase | - |
| SSU05_1552 | - | 1481611..1481715 (+) | 105 | ABP90519.1 | hypothetical protein | - |
| SSU05_1554 | - | 1481705..1483321 (-) | 1617 | ABP90520.1 | Glycosidase | - |
| SSU05_1555 | - | 1483394..1484842 (-) | 1449 | ABP90521.1 | Glycosidase | - |
Sequence
Protein
Download Length: 51 a.a. Molecular weight: 5368.18 Da Isoelectric Point: 8.7332
>NTDB_id=20101 SSU05_1550 ABP90516.1 1480431..1480586(-) (clpP) [Streptococcus suis 05ZYH33]
MGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLFKNT
MGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLFKNT
Nucleotide
Download Length: 156 bp
>NTDB_id=20101 SSU05_1550 ABP90516.1 1480431..1480586(-) (clpP) [Streptococcus suis 05ZYH33]
ATGGGAACCATCATTGCATCAAGCGGTGCCAAGGGCAAACGTTTCATGTTGCCAAATGCAGAGTACATGATTCACCAGCC
AATGGGTGGAACTGGTGGTGGTACTCAGCAAACAGATATGGCTATTGCTGCAGAACACCTATTTAAAAACACGTAA
ATGGGAACCATCATTGCATCAAGCGGTGCCAAGGGCAAACGTTTCATGTTGCCAAATGCAGAGTACATGATTCACCAGCC
AATGGGTGGAACTGGTGGTGGTACTCAGCAAACAGATATGGCTATTGCTGCAGAACACCTATTTAAAAACACGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus thermophilus LMD-9 |
95.918 |
96.078 |
0.922 |
| clpP | Streptococcus pneumoniae Rx1 |
95.918 |
96.078 |
0.922 |
| clpP | Streptococcus pneumoniae D39 |
95.918 |
96.078 |
0.922 |
| clpP | Streptococcus pneumoniae R6 |
95.918 |
96.078 |
0.922 |
| clpP | Streptococcus pneumoniae TIGR4 |
95.918 |
96.078 |
0.922 |
| clpP | Streptococcus thermophilus LMG 18311 |
95.918 |
96.078 |
0.922 |
| clpP | Streptococcus pyogenes JRS4 |
93.878 |
96.078 |
0.902 |
| clpP | Streptococcus pyogenes MGAS315 |
93.878 |
96.078 |
0.902 |
| clpP | Streptococcus mutans UA159 |
91.837 |
96.078 |
0.882 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
87.755 |
96.078 |
0.843 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
85.714 |
96.078 |
0.824 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
51.02 |
96.078 |
0.49 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
50 |
94.118 |
0.471 |