Detailed information NTG0183013

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: LLJM3_RS02180
• Genome accession: NZ_CP015901
• Coordinates: 426868..427257 (+)
• Length: 129 a.a.
• NCBI ID: WP_011675463.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain JM3
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	426871..438480	426868..427257	flank	-386

Gene organization within MGE regions

Location: 426868..438480

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLJM3_RS02180 (LLJM3_0422)	ssbB	426868..427257 (+)	390	WP_011675463.1	single-stranded DNA-binding protein	Machinery gene
LLJM3_RS02185 (LLJM3_0423)	groES	427376..427660 (+)	285	WP_011675464.1	co-chaperone GroES	-
LLJM3_RS02190 (LLJM3_0424)	groL	427747..429375 (+)	1629	WP_011675465.1	chaperonin GroEL	-
LLJM3_RS02195 (LLJM3_0425)	-	429427..430239 (-)	813	WP_011675466.1	MBL fold metallo-hydrolase	-
LLJM3_RS02200 (LLJM3_0426)	-	430429..431856 (-)	1428	WP_011675468.1	cell wall metabolism sensor histidine kinase WalK	-
LLJM3_RS02205 (LLJM3_0427)	yycF	431849..432550 (-)	702	WP_003131580.1	response regulator YycF	-
LLJM3_RS02210 (LLJM3_0428)	tmk	432728..433363 (+)	636	WP_011675469.1	dTMP kinase	-
LLJM3_RS02215 (LLJM3_0429)	-	433496..434356 (+)	861	WP_011675470.1	DNA polymerase III subunit delta'	-
LLJM3_RS02220 (LLJM3_0430)	ricT	434406..435188 (+)	783	WP_011675471.1	stage 0 sporulation family protein	-
LLJM3_RS02225 (LLJM3_0431)	yabA	435181..435507 (+)	327	WP_011675472.1	DNA replication initiation control protein YabA	-
LLJM3_RS02230 (LLJM3_0432)	rsmI	435507..436382 (+)	876	WP_011675473.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-
LLJM3_RS02235 (LLJM3_0433)	-	436460..436651 (-)	192	WP_011675474.1	hypothetical protein	-
LLJM3_RS02240 (LLJM3_0434)	-	436726..437535 (-)	810	WP_011675475.1	ABC transporter permease	-
LLJM3_RS02245 (LLJM3_0435)	-	437548..438477 (-)	930	WP_011675476.1	daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14650.71 Da
• Isoelectric Point: 6.4793

>NTDB_id=183013 LLJM3_RS02180 WP_011675463.1 426868..427257(+) (ssbB) [Lactococcus cremoris strain JM3]
MNKTMLIGHLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREADFISIILWGKSAETLVSYAKKGSLISVEGEIRTRN
YTDKNEQKHCITEILGLSYDLLESRATLALRESAVNFEELLLEADELPF

Nucleotide

• Length: 390 bp

>NTDB_id=183013 LLJM3_RS02180 WP_011675463.1 426868..427257(+) (ssbB) [Lactococcus cremoris strain JM3]
ATGAATAAAACCATGTTGATTGGTCATTTAACAAACGCACCTGAAATTTCGAAAACAACGAACAATAAATCTTATGTCCG
TGTGACTCTGGCAGTCAATCGCCGCTTCAAAAATGAAAAAGGAGAGCGAGAAGCAGACTTTATCTCGATAATTTTATGGG
GAAAATCAGCAGAAACATTGGTTTCCTATGCTAAAAAAGGAAGTCTTATTTCTGTAGAGGGAGAGATTAGAACTAGAAAT
TATACTGATAAAAATGAACAGAAACACTGTATTACAGAAATCTTAGGTTTGAGCTATGATTTATTGGAAAGTCGTGCGAC
TCTTGCCTTGAGAGAAAGCGCTGTAAATTTTGAGGAACTCTTACTTGAAGCTGATGAGCTCCCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-95)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Lactococcus lactis subsp. cremoris KW2	96.899	100	0.969
ssbB	Streptococcus sobrinus strain NIDR 6715-7	60	100	0.605
ssbB/cilA	Streptococcus pneumoniae TIGR4	56.154	100	0.566
ssbB/cilA	Streptococcus pneumoniae Rx1	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae D39	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae R6	55.385	100	0.558
ssbB/cilA	Streptococcus mitis NCTC 12261	55.385	100	0.558
ssbB/cilA	Streptococcus mitis SK321	55.385	100	0.558
ssbA	Streptococcus mutans UA159	55.385	100	0.558