Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AYM13_RS11355 | Genome accession | NZ_CP014362 |
| Coordinates | 2148070..2148540 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain USA300-SUR1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2118371..2174318 | 2148070..2148540 | within | 0 |
Gene organization within MGE regions
Location: 2118371..2174318
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM13_RS11135 (AYM13_10840) | scn | 2118371..2118721 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AYM13_RS11140 (AYM13_10845) | - | 2119406..2119855 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AYM13_RS11145 (AYM13_10850) | - | 2119950..2120285 (-) | 336 | Protein_2071 | SH3 domain-containing protein | - |
| AYM13_RS11155 (AYM13_10855) | sak | 2120935..2121426 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| AYM13_RS11160 (AYM13_10860) | - | 2121617..2122372 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AYM13_RS11165 (AYM13_10865) | - | 2122384..2122638 (-) | 255 | WP_000611512.1 | phage holin | - |
| AYM13_RS11170 (AYM13_10870) | - | 2122690..2122797 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AYM13_RS11175 | pepG1 | 2122850..2122984 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AYM13_RS11180 (AYM13_10875) | - | 2123176..2123472 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AYM13_RS11185 (AYM13_10880) | - | 2123530..2123817 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| AYM13_RS11190 (AYM13_10885) | - | 2123864..2124016 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| AYM13_RS11195 (AYM13_10890) | - | 2124006..2127791 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| AYM13_RS11200 (AYM13_10895) | - | 2127807..2129291 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| AYM13_RS11205 (AYM13_10900) | - | 2129288..2133817 (-) | 4530 | WP_001549166.1 | phage tail tape measure protein | - |
| AYM13_RS15720 | - | 2133874..2134011 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| AYM13_RS11210 (AYM13_10905) | - | 2134062..2134412 (-) | 351 | WP_001096354.1 | hypothetical protein | - |
| AYM13_RS11215 | - | 2134462..2134701 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| AYM13_RS11220 (AYM13_10910) | - | 2134728..2135372 (-) | 645 | WP_000260578.1 | major tail protein | - |
| AYM13_RS11225 (AYM13_10915) | - | 2135376..2135780 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| AYM13_RS11230 (AYM13_10920) | - | 2135777..2136181 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| AYM13_RS11235 (AYM13_10925) | - | 2136178..2136540 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AYM13_RS11240 (AYM13_10930) | - | 2136524..2136808 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AYM13_RS11245 (AYM13_10935) | - | 2136798..2137081 (-) | 284 | Protein_2091 | hypothetical protein | - |
| AYM13_RS11250 (AYM13_10940) | - | 2137101..2138246 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AYM13_RS11255 (AYM13_10945) | - | 2138270..2139007 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| AYM13_RS11260 (AYM13_10950) | - | 2138991..2140178 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| AYM13_RS11265 (AYM13_10955) | - | 2140194..2141855 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| AYM13_RS11270 (AYM13_10960) | - | 2141852..2142196 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| AYM13_RS11275 (AYM13_10965) | - | 2142326..2142625 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AYM13_RS11280 (AYM13_10970) | - | 2142857..2143273 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| AYM13_RS11285 (AYM13_10975) | - | 2143301..2143501 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AYM13_RS11290 (AYM13_10980) | - | 2143501..2143650 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AYM13_RS11295 (AYM13_10985) | - | 2143647..2144033 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| AYM13_RS11300 (AYM13_10990) | - | 2144030..2144236 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AYM13_RS11305 (AYM13_10995) | - | 2144233..2144478 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AYM13_RS11310 (AYM13_11000) | - | 2144515..2145048 (-) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| AYM13_RS11315 (AYM13_11005) | - | 2145041..2145283 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| AYM13_RS11320 (AYM13_11010) | - | 2145273..2145509 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| AYM13_RS11325 (AYM13_11015) | - | 2145502..2145873 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| AYM13_RS11330 (AYM13_11020) | - | 2145882..2146124 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| AYM13_RS11335 (AYM13_11025) | - | 2146128..2146496 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AYM13_RS11340 (AYM13_11030) | - | 2146509..2146913 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYM13_RS11345 (AYM13_11035) | - | 2146922..2147140 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| AYM13_RS11350 (AYM13_11040) | - | 2147147..2148040 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| AYM13_RS11355 (AYM13_11045) | ssbA | 2148070..2148540 (-) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM13_RS11360 (AYM13_11050) | - | 2148541..2149158 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AYM13_RS11365 (AYM13_11055) | - | 2149239..2150159 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| AYM13_RS11370 (AYM13_11060) | - | 2150161..2152104 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| AYM13_RS11375 | - | 2152113..2152376 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AYM13_RS11380 (AYM13_11065) | - | 2152385..2152645 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| AYM13_RS11385 (AYM13_11070) | - | 2152626..2152945 (-) | 320 | Protein_2119 | DUF2482 family protein | - |
| AYM13_RS11390 (AYM13_11075) | - | 2153040..2153201 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| AYM13_RS11395 (AYM13_11080) | - | 2153198..2153518 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| AYM13_RS11400 (AYM13_11085) | - | 2153577..2153807 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| AYM13_RS15725 | - | 2153804..2153980 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| AYM13_RS11405 (AYM13_11090) | - | 2153996..2154748 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM13_RS11410 (AYM13_11095) | - | 2154799..2155128 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| AYM13_RS11415 (AYM13_11100) | - | 2155117..2155332 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AYM13_RS11420 (AYM13_11105) | - | 2155348..2155611 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AYM13_RS11425 (AYM13_11110) | - | 2155608..2155781 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| AYM13_RS11430 (AYM13_11115) | - | 2155744..2156457 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AYM13_RS11435 (AYM13_11120) | - | 2156473..2157405 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AYM13_RS11440 (AYM13_11125) | - | 2157411..2157752 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| AYM13_RS11445 (AYM13_11130) | - | 2157956..2158138 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| AYM13_RS11450 (AYM13_11135) | - | 2158216..2158929 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AYM13_RS11455 (AYM13_11140) | - | 2159120..2160157 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| AYM13_RS11460 (AYM13_11145) | sph | 2160208..2161038 (+) | 831 | Protein_2135 | sphingomyelin phosphodiesterase | - |
| AYM13_RS11465 (AYM13_11150) | lukG | 2161276..2162292 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AYM13_RS11470 (AYM13_11155) | lukH | 2162314..2163369 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| AYM13_RS11475 (AYM13_11160) | - | 2163804..2165027 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| AYM13_RS11480 (AYM13_11165) | - | 2165399..2166244 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| AYM13_RS11485 (AYM13_11170) | - | 2166306..2167217 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| AYM13_RS11490 (AYM13_11175) | - | 2167378..2168685 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| AYM13_RS11500 (AYM13_11180) | - | 2169538..2169981 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| AYM13_RS11505 (AYM13_11185) | - | 2170087..2170523 (-) | 437 | Protein_2143 | hypothetical protein | - |
| AYM13_RS11510 (AYM13_11190) | - | 2170841..2171431 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| AYM13_RS11515 (AYM13_11195) | - | 2171428..2171640 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| AYM13_RS11520 | - | 2171701..2172247 (+) | 547 | Protein_2146 | site-specific integrase | - |
| AYM13_RS11525 (AYM13_11205) | groL | 2172342..2173958 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| AYM13_RS11530 (AYM13_11210) | groES | 2174034..2174318 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=170706 AYM13_RS11355 WP_000934753.1 2148070..2148540(-) (ssbA) [Staphylococcus aureus strain USA300-SUR1]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=170706 AYM13_RS11355 WP_000934753.1 2148070..2148540(-) (ssbA) [Staphylococcus aureus strain USA300-SUR1]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |