Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | RN80_RS02035 | Genome accession | NZ_CP012646 |
| Coordinates | 383515..383637 (+) | Length | 40 a.a. |
| NCBI ID | WP_060627323.1 | Uniprot ID | - |
| Organism | Streptococcus mitis strain KCOM 1350 (= ChDC B183) | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 378515..388637
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RN80_RS02010 (RN80_02020) | dnaA | 378999..380360 (-) | 1362 | WP_060627319.1 | chromosomal replication initiator protein DnaA | - |
| RN80_RS02015 (RN80_02025) | spo0J | 380573..381331 (-) | 759 | WP_060627320.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| RN80_RS02020 (RN80_02030) | htrA | 381389..382570 (-) | 1182 | WP_060627321.1 | S1C family serine protease | Regulator |
| RN80_RS02025 (RN80_02035) | rlmH | 382754..383233 (+) | 480 | WP_060627322.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| RN80_RS02035 (RN80_02045) | comC/comC2 | 383515..383637 (+) | 123 | WP_060627323.1 | competence-stimulating peptide ComC | Regulator |
| RN80_RS02040 (RN80_02050) | comD/comD1 | 383650..384975 (+) | 1326 | WP_060627324.1 | competence system sensor histidine kinase ComD | Regulator |
| RN80_RS02045 (RN80_02055) | comE | 384972..385724 (+) | 753 | WP_000866073.1 | competence system response regulator transcription factor ComE | Regulator |
| RN80_RS02060 (RN80_02070) | - | 385967..386509 (-) | 543 | WP_001158273.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4814.65 Da Isoelectric Point: 11.0668
>NTDB_id=155990 RN80_RS02035 WP_060627323.1 383515..383637(+) (comC/comC2) [Streptococcus mitis strain KCOM 1350 (= ChDC B183)]
MKNTVKLEQFVALKEKDLQKIQGGEMRKSNNNFFNFLRRI
MKNTVKLEQFVALKEKDLQKIQGGEMRKSNNNFFNFLRRI
Nucleotide
Download Length: 123 bp
>NTDB_id=155990 RN80_RS02035 WP_060627323.1 383515..383637(+) (comC/comC2) [Streptococcus mitis strain KCOM 1350 (= ChDC B183)]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGAGATGAG
GAAATCAAATAATAATTTCTTTAATTTCTTAAGAAGAATATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGAGATGAG
GAAATCAAATAATAATTTCTTTAATTTCTTAAGAAGAATATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
77.5 |
100 |
0.775 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
77.5 |
100 |
0.775 |
| comC | Streptococcus mitis SK321 |
72.5 |
100 |
0.725 |
| comC | Streptococcus mitis NCTC 12261 |
69.231 |
97.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae G54 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae D39 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae R6 |
93.103 |
72.5 |
0.675 |