Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SpyM6JRS4_RS06045 | Genome accession | NZ_CP011414 |
| Coordinates | 1220560..1220742 (-) | Length | 60 a.a. |
| NCBI ID | WP_011018104.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes JRS4 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1220560..1262054 | 1220560..1220742 | within | 0 |
Gene organization within MGE regions
Location: 1220560..1262054
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SpyM6JRS4_RS06045 (SpyM6JRS4_06040) | prx | 1220560..1220742 (-) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
| SpyM6JRS4_RS06050 (SpyM6JRS4_06045) | sda | 1220982..1221980 (+) | 999 | WP_032463908.1 | streptodornase A | - |
| SpyM6JRS4_RS06055 (SpyM6JRS4_06050) | - | 1222121..1222714 (-) | 594 | WP_003051628.1 | GNAT family N-acetyltransferase | - |
| SpyM6JRS4_RS06060 (SpyM6JRS4_06055) | - | 1222714..1222878 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| SpyM6JRS4_RS06065 (SpyM6JRS4_06060) | - | 1223027..1224232 (-) | 1206 | WP_023078214.1 | glucosaminidase domain-containing protein | - |
| SpyM6JRS4_RS06075 (SpyM6JRS4_06070) | - | 1224345..1224530 (-) | 186 | WP_011184796.1 | holin | - |
| SpyM6JRS4_RS06080 (SpyM6JRS4_06075) | - | 1224527..1224826 (-) | 300 | WP_011184797.1 | hypothetical protein | - |
| SpyM6JRS4_RS06085 (SpyM6JRS4_06080) | - | 1224837..1225454 (-) | 618 | WP_011018111.1 | DUF1366 domain-containing protein | - |
| SpyM6JRS4_RS06090 (SpyM6JRS4_06085) | - | 1225457..1225885 (-) | 429 | WP_011184798.1 | DUF1617 family protein | - |
| SpyM6JRS4_RS06095 (SpyM6JRS4_06090) | - | 1225897..1227912 (-) | 2016 | WP_011184799.1 | gp58-like family protein | - |
| SpyM6JRS4_RS06100 (SpyM6JRS4_06095) | - | 1227927..1229039 (-) | 1113 | WP_011184800.1 | hyaluronoglucosaminidase | - |
| SpyM6JRS4_RS06105 (SpyM6JRS4_06100) | - | 1229039..1231186 (-) | 2148 | WP_023078210.1 | phage tail spike protein | - |
| SpyM6JRS4_RS06110 (SpyM6JRS4_06105) | - | 1231183..1231899 (-) | 717 | WP_011018116.1 | distal tail protein Dit | - |
| SpyM6JRS4_RS06115 (SpyM6JRS4_06110) | - | 1231896..1235156 (-) | 3261 | WP_047149499.1 | tape measure protein | - |
| SpyM6JRS4_RS06120 (SpyM6JRS4_06115) | - | 1235146..1235727 (-) | 582 | WP_011018118.1 | Gp15 family bacteriophage protein | - |
| SpyM6JRS4_RS06125 (SpyM6JRS4_06120) | - | 1235731..1236165 (-) | 435 | WP_011018119.1 | hypothetical protein | - |
| SpyM6JRS4_RS06130 (SpyM6JRS4_06125) | - | 1236209..1236670 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| SpyM6JRS4_RS06135 (SpyM6JRS4_06130) | - | 1236670..1237068 (-) | 399 | WP_011018121.1 | minor capsid protein | - |
| SpyM6JRS4_RS06140 (SpyM6JRS4_06135) | - | 1237065..1237421 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| SpyM6JRS4_RS06145 (SpyM6JRS4_06140) | - | 1237421..1237753 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| SpyM6JRS4_RS06150 (SpyM6JRS4_06145) | - | 1237743..1238159 (-) | 417 | WP_011018123.1 | hypothetical protein | - |
| SpyM6JRS4_RS06155 (SpyM6JRS4_06150) | - | 1238213..1239031 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SpyM6JRS4_RS06160 (SpyM6JRS4_06155) | - | 1239035..1239649 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| SpyM6JRS4_RS06165 (SpyM6JRS4_06160) | - | 1239775..1240041 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| SpyM6JRS4_RS06170 (SpyM6JRS4_06165) | - | 1240128..1240355 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| SpyM6JRS4_RS06175 (SpyM6JRS4_06170) | - | 1240355..1241848 (-) | 1494 | WP_011018124.1 | phage minor capsid protein | - |
| SpyM6JRS4_RS06180 (SpyM6JRS4_06175) | - | 1241853..1243354 (-) | 1502 | Protein_1192 | phage portal protein | - |
| SpyM6JRS4_RS06185 (SpyM6JRS4_06180) | - | 1243368..1244659 (-) | 1292 | Protein_1193 | PBSX family phage terminase large subunit | - |
| SpyM6JRS4_RS06190 (SpyM6JRS4_06185) | - | 1244662..1245135 (-) | 474 | WP_011018127.1 | hypothetical protein | - |
| SpyM6JRS4_RS06195 (SpyM6JRS4_06190) | - | 1245186..1245563 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| SpyM6JRS4_RS09260 (SpyM6JRS4_06195) | - | 1245624..1246100 (-) | 477 | WP_174148345.1 | GNAT family N-acetyltransferase | - |
| SpyM6JRS4_RS06205 (SpyM6JRS4_06200) | - | 1246016..1246693 (-) | 678 | WP_011018129.1 | ABC transporter ATP-binding protein | - |
| SpyM6JRS4_RS06210 (SpyM6JRS4_06205) | - | 1246672..1247190 (-) | 519 | WP_011018130.1 | ParB N-terminal domain-containing protein | - |
| SpyM6JRS4_RS06215 (SpyM6JRS4_06210) | - | 1247654..1248094 (-) | 441 | WP_002990052.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SpyM6JRS4_RS06220 (SpyM6JRS4_06215) | - | 1248368..1248634 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| SpyM6JRS4_RS06225 (SpyM6JRS4_06220) | - | 1248631..1249002 (-) | 372 | WP_011018132.1 | DUF1642 domain-containing protein | - |
| SpyM6JRS4_RS06230 (SpyM6JRS4_06225) | - | 1249123..1249755 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| SpyM6JRS4_RS06235 (SpyM6JRS4_06230) | - | 1249757..1250041 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| SpyM6JRS4_RS09655 | - | 1250038..1250208 (-) | 171 | WP_011018135.1 | hypothetical protein | - |
| SpyM6JRS4_RS06240 (SpyM6JRS4_06235) | - | 1250205..1250609 (-) | 405 | WP_011018136.1 | YopX family protein | - |
| SpyM6JRS4_RS06245 (SpyM6JRS4_06240) | - | 1250606..1250890 (-) | 285 | Protein_1206 | DUF3310 domain-containing protein | - |
| SpyM6JRS4_RS09895 (SpyM6JRS4_06245) | - | 1250884..1251135 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| SpyM6JRS4_RS06255 (SpyM6JRS4_06250) | - | 1251132..1251488 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| SpyM6JRS4_RS06260 (SpyM6JRS4_06255) | - | 1251485..1251925 (-) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SpyM6JRS4_RS06265 (SpyM6JRS4_06260) | - | 1251925..1252128 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| SpyM6JRS4_RS06270 (SpyM6JRS4_06265) | ssbA | 1252134..1252553 (-) | 420 | WP_011018140.1 | single-stranded DNA-binding protein | Machinery gene |
| SpyM6JRS4_RS06275 (SpyM6JRS4_06270) | - | 1252546..1253220 (-) | 675 | WP_011018141.1 | ERF family protein | - |
| SpyM6JRS4_RS06280 (SpyM6JRS4_06275) | - | 1253221..1253703 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SpyM6JRS4_RS06285 (SpyM6JRS4_06280) | - | 1253725..1253979 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| SpyM6JRS4_RS06290 (SpyM6JRS4_06285) | - | 1253960..1254316 (-) | 357 | WP_011018144.1 | HTH domain-containing protein | - |
| SpyM6JRS4_RS09660 | - | 1254327..1254464 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| SpyM6JRS4_RS06295 (SpyM6JRS4_06290) | - | 1254464..1255306 (-) | 843 | WP_011018146.1 | ATP-binding protein | - |
| SpyM6JRS4_RS06300 (SpyM6JRS4_06295) | - | 1255316..1256236 (-) | 921 | WP_021340238.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SpyM6JRS4_RS06305 (SpyM6JRS4_06300) | - | 1256250..1256564 (-) | 315 | WP_021340228.1 | helix-turn-helix domain-containing protein | - |
| SpyM6JRS4_RS09840 | - | 1256580..1256714 (-) | 135 | WP_021340229.1 | hypothetical protein | - |
| SpyM6JRS4_RS06310 (SpyM6JRS4_06305) | - | 1256745..1256996 (-) | 252 | WP_021340237.1 | AlpA family transcriptional regulator | - |
| SpyM6JRS4_RS09665 | - | 1257235..1257402 (-) | 168 | WP_021340232.1 | hypothetical protein | - |
| SpyM6JRS4_RS06320 (SpyM6JRS4_06315) | - | 1257406..1258125 (-) | 720 | WP_011018149.1 | phage antirepressor KilAC domain-containing protein | - |
| SpyM6JRS4_RS06325 (SpyM6JRS4_06320) | - | 1258153..1258365 (-) | 213 | WP_023078130.1 | hypothetical protein | - |
| SpyM6JRS4_RS06330 (SpyM6JRS4_06325) | - | 1258563..1258904 (+) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| SpyM6JRS4_RS06335 (SpyM6JRS4_06330) | - | 1258888..1259274 (+) | 387 | WP_032463929.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SpyM6JRS4_RS06340 (SpyM6JRS4_06335) | - | 1259289..1260710 (+) | 1422 | WP_011018151.1 | DUF4041 domain-containing protein | - |
| SpyM6JRS4_RS06345 (SpyM6JRS4_06340) | - | 1260888..1262054 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6935.81 Da Isoelectric Point: 3.9417
>NTDB_id=145759 SpyM6JRS4_RS06045 WP_011018104.1 1220560..1220742(-) (prx) [Streptococcus pyogenes JRS4]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=145759 SpyM6JRS4_RS06045 WP_011018104.1 1220560..1220742(-) (prx) [Streptococcus pyogenes JRS4]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
71.667 |
0.667 |