Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | ACLV7Q_RS10220 | Genome accession | NZ_OZ217341 |
| Coordinates | 2138644..2138769 (-) | Length | 41 a.a. |
| NCBI ID | WP_218757899.1 | Uniprot ID | - |
| Organism | Streptococcus mitis isolate S. mitis C22 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2133644..2143769
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLV7Q_RS10195 (SMIC22_20170) | - | 2135764..2136306 (+) | 543 | WP_057488235.1 | TetR/AcrR family transcriptional regulator | - |
| ACLV7Q_RS10210 (SMIC22_20200) | comE | 2136549..2137301 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| ACLV7Q_RS10215 (SMIC22_20210) | comD/comD1 | 2137298..2138623 (-) | 1326 | WP_218757900.1 | GHKL domain-containing protein | Regulator |
| ACLV7Q_RS10220 (SMIC22_20220) | comC/comC1 | 2138644..2138769 (-) | 126 | WP_218757899.1 | competence-stimulating peptide ComC | Regulator |
| ACLV7Q_RS10230 (SMIC22_20240) | rlmH | 2139052..2139531 (-) | 480 | WP_084367488.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ACLV7Q_RS10235 (SMIC22_20250) | htrA | 2139715..2140896 (+) | 1182 | WP_176139267.1 | S1C family serine protease | Regulator |
| ACLV7Q_RS10240 (SMIC22_20260) | spo0J | 2140954..2141712 (+) | 759 | WP_218757898.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4877.81 Da Isoelectric Point: 10.9061
>NTDB_id=1170076 ACLV7Q_RS10220 WP_218757899.1 2138644..2138769(-) (comC/comC1) [Streptococcus mitis isolate S. mitis C22]
MKNTVKLEQFVALKEKDLQKIKGGESRLSRLLRDFIFQIKQ
MKNTVKLEQFVALKEKDLQKIKGGESRLSRLLRDFIFQIKQ
Nucleotide
Download Length: 126 bp
>NTDB_id=1170076 ACLV7Q_RS10220 WP_218757899.1 2138644..2138769(-) (comC/comC1) [Streptococcus mitis isolate S. mitis C22]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAAGTAG
ACTGTCAAGATTACTCCGTGATTTTATTTTCCAAATAAAACAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAAGTAG
ACTGTCAAGATTACTCCGTGATTTTATTTTCCAAATAAAACAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae G54 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae D39 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae R6 |
82.927 |
100 |
0.829 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC/comC2 | Streptococcus pneumoniae A66 |
83.784 |
90.244 |
0.756 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
83.784 |
90.244 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |