Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QOR59_RS01095 | Genome accession | NZ_OX460985 |
| Coordinates | 189000..189329 (+) | Length | 109 a.a. |
| NCBI ID | WP_000793380.1 | Uniprot ID | A0A0E1EKJ1 |
| Organism | Streptococcus agalactiae isolate MRI Z2-307 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 189919..233089 | 189000..189329 | flank | 590 |
Gene organization within MGE regions
Location: 189000..233089
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOR59_RS01095 | comGC/cglC | 189000..189329 (+) | 330 | WP_000793380.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QOR59_RS01100 | comYD | 189304..189717 (+) | 414 | WP_000244259.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| QOR59_RS01105 | comGE | 189689..189988 (+) | 300 | WP_001867089.1 | competence type IV pilus minor pilin ComGE | - |
| QOR59_RS01110 | comGF | 189942..190403 (+) | 462 | WP_001874060.1 | competence type IV pilus minor pilin ComGF | - |
| QOR59_RS01115 | comGG | 190381..190752 (+) | 372 | WP_000601104.1 | competence type IV pilus minor pilin ComGG | - |
| QOR59_RS01120 | comYH | 190867..191841 (+) | 975 | WP_001008570.1 | class I SAM-dependent methyltransferase | Machinery gene |
| QOR59_RS01125 | - | 191873..193066 (+) | 1194 | WP_000047535.1 | acetate kinase | - |
| QOR59_RS01130 | - | 193217..193423 (+) | 207 | WP_000798242.1 | helix-turn-helix transcriptional regulator | - |
| QOR59_RS01135 | - | 193482..193619 (+) | 138 | WP_001867090.1 | hypothetical protein | - |
| QOR59_RS01140 | - | 193660..194115 (+) | 456 | WP_000905674.1 | hypothetical protein | - |
| QOR59_RS01145 | - | 194184..194849 (+) | 666 | WP_000008111.1 | type II CAAX endopeptidase family protein | - |
| QOR59_RS01150 | proC | 194870..195640 (-) | 771 | WP_001867096.1 | pyrroline-5-carboxylate reductase | - |
| QOR59_RS01155 | pepA | 195710..196777 (-) | 1068 | WP_001281321.1 | glutamyl aminopeptidase | - |
| QOR59_RS01160 | - | 196962..197201 (-) | 240 | WP_000660181.1 | hypothetical protein | - |
| QOR59_RS01165 | - | 197362..197646 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| QOR59_RS01170 | - | 197643..197966 (+) | 324 | WP_000601792.1 | thioredoxin family protein | - |
| QOR59_RS01175 | ytpR | 197999..198625 (+) | 627 | WP_000578331.1 | YtpR family tRNA-binding protein | - |
| QOR59_RS01180 | - | 198679..199395 (-) | 717 | WP_000186183.1 | class I SAM-dependent methyltransferase | - |
| QOR59_RS01185 | ssbA | 199476..199871 (+) | 396 | WP_000282450.1 | single-stranded DNA-binding protein | Machinery gene |
| QOR59_RS01190 | - | 199994..200638 (+) | 645 | WP_000416612.1 | HAD family hydrolase | - |
| QOR59_RS01195 | - | 200665..202410 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| QOR59_RS01200 | - | 202391..203131 (+) | 741 | WP_000697630.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | - |
| QOR59_RS01205 | - | 203301..203756 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| QOR59_RS01210 | lrgB | 203758..204486 (+) | 729 | WP_000421727.1 | antiholin-like protein LrgB | - |
| QOR59_RS01215 | - | 204729..206357 (+) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| QOR59_RS01220 | - | 206470..207447 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| QOR59_RS01225 | - | 207444..208265 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| QOR59_RS01230 | - | 208277..209080 (+) | 804 | WP_000140979.1 | ABC transporter ATP-binding protein | - |
| QOR59_RS01235 | - | 209064..209690 (+) | 627 | WP_000171304.1 | ABC transporter ATP-binding protein | - |
| QOR59_RS01240 | treP | 209972..212002 (+) | 2031 | WP_017768545.1 | PTS system trehalose-specific EIIBC component | - |
| QOR59_RS01245 | treC | 212224..213849 (+) | 1626 | WP_000151014.1 | alpha,alpha-phosphotrehalase | - |
| QOR59_RS01250 | - | 214069..216105 (+) | 2037 | WP_000228178.1 | BglG family transcription antiterminator | - |
| QOR59_RS01255 | - | 216108..216392 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| QOR59_RS01260 | - | 216405..217760 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| QOR59_RS01265 | - | 217763..218620 (+) | 858 | WP_000203492.1 | transketolase | - |
| QOR59_RS01270 | - | 218617..219546 (+) | 930 | WP_001203827.1 | transketolase C-terminal domain-containing protein | - |
| QOR59_RS01275 | - | 219655..220914 (+) | 1260 | WP_001203074.1 | ferric reductase-like transmembrane domain-containing protein | - |
| QOR59_RS01280 | rpsO | 221002..221271 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| QOR59_RS01285 | pnp | 221652..223781 (+) | 2130 | WP_000043857.1 | polyribonucleotide nucleotidyltransferase | - |
| QOR59_RS01290 | - | 223783..224535 (+) | 753 | WP_000204784.1 | SseB family protein | - |
| QOR59_RS01295 | cysE | 224544..225128 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| QOR59_RS01300 | - | 225138..225320 (+) | 183 | WP_000656477.1 | hypothetical protein | - |
| QOR59_RS01305 | cysS | 225317..226660 (+) | 1344 | WP_000591129.1 | cysteine--tRNA ligase | - |
| QOR59_RS01310 | - | 226653..227039 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| QOR59_RS01315 | rlmB | 227142..227897 (+) | 756 | WP_000178019.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| QOR59_RS01320 | - | 227894..228412 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| QOR59_RS01325 | - | 228505..229365 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| QOR59_RS01330 | - | 229903..230022 (+) | 120 | Protein_209 | helix-turn-helix domain-containing protein | - |
| QOR59_RS01335 | - | 230340..231506 (-) | 1167 | WP_000160598.1 | IS30-like element ISSag9 family transposase | - |
| QOR59_RS01340 | rplM | 231807..232253 (+) | 447 | WP_001867156.1 | 50S ribosomal protein L13 | - |
| QOR59_RS01345 | rpsI | 232274..232666 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
Sequence
Protein
Download Length: 109 a.a. Molecular weight: 12129.27 Da Isoelectric Point: 10.0311
>NTDB_id=1159585 QOR59_RS01095 WP_000793380.1 189000..189329(+) (comGC/cglC) [Streptococcus agalactiae isolate MRI Z2-307]
MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKESVTRTGNAAVVKVVESQAELFELQETGRKASLSTLK
SGGYITEKQEKAYLDYYKDSSNGSQKISS
MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKESVTRTGNAAVVKVVESQAELFELQETGRKASLSTLK
SGGYITEKQEKAYLDYYKDSSNGSQKISS
Nucleotide
Download Length: 330 bp
>NTDB_id=1159585 QOR59_RS01095 WP_000793380.1 189000..189329(+) (comGC/cglC) [Streptococcus agalactiae isolate MRI Z2-307]
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAAATGTTAGTTGTTTTGATCAT
TATTTCGGTCTTGTTGTTATTGTTTGTGCCCAATTTATCAAAACAAAAGGAAAGTGTCACAAGAACTGGAAATGCCGCTG
TTGTCAAGGTTGTAGAAAGTCAAGCCGAACTTTTTGAACTGCAAGAAACAGGTAGAAAAGCTAGTTTATCCACTCTAAAA
TCTGGAGGATATATTACTGAAAAGCAAGAAAAAGCCTATTTAGATTATTATAAAGACAGTTCCAATGGTTCTCAGAAAAT
TTCAAGTTAA
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAAATGTTAGTTGTTTTGATCAT
TATTTCGGTCTTGTTGTTATTGTTTGTGCCCAATTTATCAAAACAAAAGGAAAGTGTCACAAGAACTGGAAATGCCGCTG
TTGTCAAGGTTGTAGAAAGTCAAGCCGAACTTTTTGAACTGCAAGAAACAGGTAGAAAAGCTAGTTTATCCACTCTAAAA
TCTGGAGGATATATTACTGAAAAGCAAGAAAAAGCCTATTTAGATTATTATAAAGACAGTTCCAATGGTTCTCAGAAAAT
TTCAAGTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus mitis NCTC 12261 |
60.55 |
100 |
0.606 |
| comGC/cglC | Streptococcus mitis SK321 |
59.633 |
100 |
0.596 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
61.165 |
94.495 |
0.578 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
57.798 |
100 |
0.578 |
| comGC/cglC | Streptococcus pneumoniae R6 |
57.798 |
100 |
0.578 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
57.798 |
100 |
0.578 |
| comGC/cglC | Streptococcus pneumoniae D39 |
57.798 |
100 |
0.578 |
| comYC | Streptococcus mutans UA159 |
55.238 |
96.33 |
0.532 |
| comYC | Streptococcus mutans UA140 |
55.238 |
96.33 |
0.532 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
63.043 |
84.404 |
0.532 |
| comYC | Streptococcus suis isolate S10 |
65.854 |
75.229 |
0.495 |