Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN35_RS04375 | Genome accession | NZ_LS483442 |
| Coordinates | 821342..821530 (+) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8370 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 782803..829114 | 821342..821530 | within | 0 |
Gene organization within MGE regions
Location: 782803..829114
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN35_RS04090 (NCTC8370_00805) | - | 782803..783423 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DQN35_RS04095 (NCTC8370_00806) | - | 783786..784874 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| DQN35_RS04100 (NCTC8370_00807) | - | 784995..785888 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| DQN35_RS04105 (NCTC8370_00808) | - | 785924..786748 (-) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| DQN35_RS04110 (NCTC8370_00810) | - | 787105..787263 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| DQN35_RS04115 (NCTC8370_00811) | - | 787293..787892 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DQN35_RS04120 (NCTC8370_00812) | - | 787946..788155 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DQN35_RS04125 (NCTC8370_00813) | - | 788144..788530 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DQN35_RS04130 (NCTC8370_00814) | - | 788604..788804 (+) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| DQN35_RS04135 (NCTC8370_00815) | - | 788914..789123 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| DQN35_RS09380 | - | 789254..789493 (-) | 240 | WP_227874181.1 | hypothetical protein | - |
| DQN35_RS09385 | - | 789727..789915 (+) | 189 | Protein_738 | XRE family transcriptional regulator | - |
| DQN35_RS04150 (NCTC8370_00817) | - | 789929..790759 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQN35_RS04155 (NCTC8370_00818) | - | 790746..791528 (+) | 783 | WP_011285581.1 | ATP-binding protein | - |
| DQN35_RS04160 (NCTC8370_00820) | - | 791669..792022 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| DQN35_RS04165 (NCTC8370_00821) | - | 792003..792257 (+) | 255 | WP_011285578.1 | hypothetical protein | - |
| DQN35_RS04170 (NCTC8370_00822) | - | 792279..792761 (+) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| DQN35_RS04175 (NCTC8370_00823) | - | 792762..793436 (+) | 675 | WP_111713462.1 | ERF family protein | - |
| DQN35_RS04180 (NCTC8370_00824) | ssb | 793429..793854 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| DQN35_RS04185 | - | 793860..794063 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQN35_RS04190 (NCTC8370_00825) | - | 794063..794503 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQN35_RS04195 (NCTC8370_00826) | - | 794500..794856 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DQN35_RS09520 (NCTC8370_00827) | - | 794853..795098 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| DQN35_RS04205 (NCTC8370_00828) | - | 795098..795334 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DQN35_RS09265 (NCTC8370_00829) | - | 795331..795501 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DQN35_RS04210 (NCTC8370_00830) | - | 795498..795782 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| DQN35_RS04215 (NCTC8370_00831) | - | 795784..796416 (+) | 633 | WP_111713463.1 | N-6 DNA methylase | - |
| DQN35_RS04220 (NCTC8370_00832) | - | 796419..796943 (+) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| DQN35_RS04225 (NCTC8370_00833) | - | 796940..797206 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| DQN35_RS04230 (NCTC8370_00834) | - | 797492..797926 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQN35_RS04235 (NCTC8370_00835) | - | 798536..798916 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQN35_RS04240 (NCTC8370_00836) | - | 798906..800180 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| DQN35_RS04245 (NCTC8370_00837) | - | 800180..801505 (+) | 1326 | WP_011285570.1 | phage portal protein | - |
| DQN35_RS04250 (NCTC8370_00838) | - | 801474..802382 (+) | 909 | WP_011285569.1 | minor capsid protein | - |
| DQN35_RS04255 (NCTC8370_00839) | - | 802389..802658 (+) | 270 | WP_011285568.1 | hypothetical protein | - |
| DQN35_RS09490 (NCTC8370_00840) | - | 802660..802794 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| DQN35_RS04260 (NCTC8370_00841) | - | 802903..803472 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| DQN35_RS04265 (NCTC8370_00842) | - | 803491..804381 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| DQN35_RS04270 (NCTC8370_00843) | - | 804394..804687 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| DQN35_RS04275 (NCTC8370_00844) | - | 804701..805045 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| DQN35_RS04280 (NCTC8370_00845) | - | 805042..805353 (+) | 312 | WP_011285567.1 | hypothetical protein | - |
| DQN35_RS04285 (NCTC8370_00846) | - | 805350..805745 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| DQN35_RS04290 (NCTC8370_00847) | - | 805747..806157 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| DQN35_RS04295 (NCTC8370_00848) | - | 806169..806675 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| DQN35_RS04300 (NCTC8370_00849) | - | 806688..807005 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| DQN35_RS04305 (NCTC8370_00850) | - | 806978..807436 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| DQN35_RS04310 (NCTC8370_00851) | - | 807429..809234 (+) | 1806 | WP_011054802.1 | tail protein | - |
| DQN35_RS04315 (NCTC8370_00852) | - | 809235..810719 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| DQN35_RS04320 (NCTC8370_00853) | - | 810720..814160 (+) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| DQN35_RS04325 (NCTC8370_00854) | - | 814165..816027 (+) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| DQN35_RS04330 (NCTC8370_00855) | - | 816038..816385 (+) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| DQN35_RS09495 (NCTC8370_00856) | - | 816399..816521 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQN35_RS04335 (NCTC8370_00857) | - | 816535..816858 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQN35_RS04340 (NCTC8370_00858) | - | 816858..817190 (+) | 333 | WP_011285562.1 | phage holin | - |
| DQN35_RS04345 (NCTC8370_00859) | - | 817192..817956 (+) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| DQN35_RS04350 (NCTC8370_00860) | - | 817968..818570 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQN35_RS04355 (NCTC8370_00861) | - | 818581..819354 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| DQN35_RS04360 (NCTC8370_00862) | - | 819364..819585 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQN35_RS04365 (NCTC8370_00863) | - | 819585..820244 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| DQN35_RS04370 (NCTC8370_00864) | speA | 820366..821121 (-) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DQN35_RS04375 (NCTC8370_00865) | prx | 821342..821530 (+) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| DQN35_RS04385 (NCTC8370_00867) | - | 822121..822735 (+) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| DQN35_RS04390 (NCTC8370_00868) | - | 822862..823647 (-) | 786 | WP_010922378.1 | hypothetical protein | - |
| DQN35_RS04395 (NCTC8370_00869) | - | 823657..824355 (-) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DQN35_RS04400 (NCTC8370_00870) | - | 824355..824726 (-) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| DQN35_RS04405 (NCTC8370_00871) | - | 824911..828021 (+) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| DQN35_RS04410 (NCTC8370_00872) | pfkA | 828101..829114 (+) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1141656 DQN35_RS04375 WP_011285559.1 821342..821530(+) (prx) [Streptococcus pyogenes strain NCTC8370]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1141656 DQN35_RS04375 WP_011285559.1 821342..821530(+) (prx) [Streptococcus pyogenes strain NCTC8370]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |