Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN32_RS06355 | Genome accession | NZ_LS483432 |
| Coordinates | 1230242..1230424 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain NCTC13745 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1230242..1271678 | 1230242..1230424 | within | 0 |
Gene organization within MGE regions
Location: 1230242..1271678
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN32_RS06355 (NCTC13745_01266) | prx | 1230242..1230424 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| DQN32_RS06365 (NCTC13745_01268) | - | 1230770..1231345 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| DQN32_RS06370 (NCTC13745_01269) | spek | 1231821..1232600 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DQN32_RS06375 (NCTC13745_01270) | - | 1232904..1233770 (-) | 867 | WP_076639317.1 | DUF334 domain-containing protein | - |
| DQN32_RS06380 (NCTC13745_01271) | - | 1233758..1234282 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| DQN32_RS06385 (NCTC13745_01272) | - | 1234422..1235624 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| DQN32_RS06390 (NCTC13745_01274) | - | 1235740..1235967 (-) | 228 | WP_011054444.1 | phage holin | - |
| DQN32_RS06395 (NCTC13745_01275) | - | 1235964..1236236 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQN32_RS06400 (NCTC13745_01276) | - | 1236248..1236880 (-) | 633 | WP_011054443.1 | hypothetical protein | - |
| DQN32_RS06405 (NCTC13745_01277) | - | 1236883..1237311 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DQN32_RS06410 (NCTC13745_01278) | - | 1237323..1239212 (-) | 1890 | WP_111681974.1 | gp58-like family protein | - |
| DQN32_RS06415 (NCTC13745_01279) | - | 1239223..1239537 (-) | 315 | WP_063812987.1 | hypothetical protein | - |
| DQN32_RS06420 (NCTC13745_01280) | - | 1239539..1240753 (-) | 1215 | WP_111681975.1 | hypothetical protein | - |
| DQN32_RS06425 (NCTC13745_01281) | - | 1240750..1242897 (-) | 2148 | WP_076639318.1 | phage tail spike protein | - |
| DQN32_RS06430 (NCTC13745_01282) | - | 1242894..1243610 (-) | 717 | WP_076639319.1 | distal tail protein Dit | - |
| DQN32_RS06435 (NCTC13745_01283) | - | 1243607..1246867 (-) | 3261 | WP_076639320.1 | tape measure protein | - |
| DQN32_RS06440 (NCTC13745_01284) | - | 1246857..1247438 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| DQN32_RS06445 (NCTC13745_01285) | - | 1247442..1247876 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| DQN32_RS06450 (NCTC13745_01286) | - | 1247915..1248400 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| DQN32_RS06455 (NCTC13745_01287) | - | 1248400..1248798 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQN32_RS06460 (NCTC13745_01288) | - | 1248795..1249151 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQN32_RS06465 (NCTC13745_01289) | - | 1249151..1249483 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQN32_RS06470 (NCTC13745_01290) | - | 1249473..1249889 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| DQN32_RS06475 (NCTC13745_01291) | - | 1249943..1250761 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQN32_RS06480 (NCTC13745_01292) | - | 1250765..1251379 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| DQN32_RS06485 (NCTC13745_01293) | - | 1251505..1251771 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| DQN32_RS06490 (NCTC13745_01294) | - | 1251833..1252072 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| DQN32_RS06495 (NCTC13745_01295) | - | 1252044..1253522 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| DQN32_RS06500 (NCTC13745_01296) | - | 1253527..1255029 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| DQN32_RS06505 (NCTC13745_01297) | - | 1255043..1256334 (-) | 1292 | Protein_1212 | PBSX family phage terminase large subunit | - |
| DQN32_RS06510 (NCTC13745_01298) | - | 1256337..1256810 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| DQN32_RS06515 (NCTC13745_01299) | - | 1256861..1257238 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DQN32_RS06520 | - | 1257299..1257730 (-) | 432 | WP_074375320.1 | GNAT family N-acetyltransferase | - |
| DQN32_RS06525 (NCTC13745_01300) | - | 1257708..1258226 (-) | 519 | WP_076639322.1 | ParB N-terminal domain-containing protein | - |
| DQN32_RS06530 | - | 1258307..1258564 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| DQN32_RS06550 (NCTC13745_01301) | - | 1259203..1259643 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQN32_RS09475 (NCTC13745_01302) | - | 1259917..1260087 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| DQN32_RS06555 (NCTC13745_01303) | - | 1260084..1260590 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| DQN32_RS09480 (NCTC13745_01304) | - | 1260587..1260757 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| DQN32_RS06560 (NCTC13745_01305) | - | 1260754..1261158 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| DQN32_RS06565 (NCTC13745_01306) | - | 1261168..1261437 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| DQN32_RS06570 (NCTC13745_01307) | - | 1261434..1261718 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| DQN32_RS06575 (NCTC13745_01308) | - | 1261712..1261963 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| DQN32_RS06580 (NCTC13745_01309) | - | 1261960..1262316 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| DQN32_RS06585 (NCTC13745_01310) | - | 1262313..1262753 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQN32_RS06590 | - | 1262753..1262956 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQN32_RS06595 (NCTC13745_01311) | ssbA | 1262962..1263381 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| DQN32_RS06600 (NCTC13745_01312) | - | 1263374..1264048 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| DQN32_RS06605 (NCTC13745_01313) | - | 1264049..1264531 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DQN32_RS06610 (NCTC13745_01314) | - | 1264553..1264807 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| DQN32_RS06615 (NCTC13745_01315) | - | 1264818..1264958 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| DQN32_RS06620 (NCTC13745_01316) | - | 1264955..1265188 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| DQN32_RS06625 (NCTC13745_01317) | - | 1265169..1265582 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| DQN32_RS06630 (NCTC13745_01318) | - | 1265704..1265961 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| DQN32_RS06635 (NCTC13745_01319) | - | 1266055..1266240 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| DQN32_RS06640 (NCTC13745_01320) | - | 1266269..1266526 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| DQN32_RS06650 (NCTC13745_01322) | - | 1266772..1266939 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| DQN32_RS06655 (NCTC13745_01323) | - | 1267015..1267215 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| DQN32_RS09485 (NCTC13745_01324) | - | 1267212..1267361 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| DQN32_RS06660 (NCTC13745_01325) | - | 1267394..1268122 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| DQN32_RS06665 (NCTC13745_01326) | - | 1268133..1268324 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| DQN32_RS06670 (NCTC13745_01327) | - | 1269126..1269479 (+) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| DQN32_RS06675 (NCTC13745_01328) | - | 1269493..1269873 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQN32_RS06680 (NCTC13745_01329) | - | 1269884..1270405 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| DQN32_RS06685 (NCTC13745_01330) | - | 1270581..1271678 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=1141341 DQN32_RS06355 WP_011054726.1 1230242..1230424(-) (prx) [Streptococcus pyogenes strain NCTC13745]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1141341 DQN32_RS06355 WP_011054726.1 1230242..1230424(-) (prx) [Streptococcus pyogenes strain NCTC13745]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |