Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM47_RS10190 | Genome accession | NZ_LS483360 |
| Coordinates | 1796838..1796999 (+) | Length | 53 a.a. |
| NCBI ID | WP_309543630.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC10876 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1758747..1796999 | 1796838..1796999 | within | 0 |
Gene organization within MGE regions
Location: 1758747..1796999
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM47_RS09055 (NCTC10876_01799) | groL | 1759264..1760895 (-) | 1632 | WP_002982320.1 | chaperonin GroEL | - |
| DQM47_RS09060 (NCTC10876_01800) | groES | 1760931..1761221 (-) | 291 | WP_002991292.1 | co-chaperone GroES | - |
| DQM47_RS09065 (NCTC10876_01801) | clpC | 1761399..1763843 (-) | 2445 | WP_023610724.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
| DQM47_RS09070 (NCTC10876_01802) | - | 1763843..1764304 (-) | 462 | WP_023610213.1 | CtsR family transcriptional regulator | - |
| DQM47_RS09075 | - | 1764500..1764703 (-) | 204 | WP_002991299.1 | cold-shock protein | - |
| DQM47_RS09080 (NCTC10876_01804) | - | 1765293..1766363 (-) | 1071 | WP_063629765.1 | tyrosine-type recombinase/integrase | - |
| DQM47_RS09085 (NCTC10876_01805) | - | 1766491..1766793 (-) | 303 | WP_111685849.1 | hypothetical protein | - |
| DQM47_RS09090 (NCTC10876_01806) | - | 1766786..1767172 (-) | 387 | WP_063629763.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM47_RS09095 (NCTC10876_01807) | - | 1767176..1767526 (-) | 351 | WP_063629762.1 | helix-turn-helix domain-containing protein | - |
| DQM47_RS09105 (NCTC10876_01808) | - | 1767923..1768132 (+) | 210 | WP_111685850.1 | helix-turn-helix domain-containing protein | - |
| DQM47_RS09110 (NCTC10876_01809) | - | 1768132..1768494 (+) | 363 | WP_063629760.1 | hypothetical protein | - |
| DQM47_RS09115 (NCTC10876_01810) | - | 1768516..1768800 (+) | 285 | WP_063629759.1 | hypothetical protein | - |
| DQM47_RS09120 (NCTC10876_01811) | - | 1768827..1769045 (+) | 219 | WP_063629758.1 | hypothetical protein | - |
| DQM47_RS09125 (NCTC10876_01812) | dnaB | 1769054..1770400 (+) | 1347 | WP_111685851.1 | replicative DNA helicase | - |
| DQM47_RS09130 (NCTC10876_01813) | - | 1770387..1771133 (+) | 747 | WP_111685852.1 | conserved phage C-terminal domain-containing protein | - |
| DQM47_RS09135 (NCTC10876_01814) | - | 1771134..1771955 (+) | 822 | WP_111685853.1 | ATP-binding protein | - |
| DQM47_RS09140 (NCTC10876_01815) | - | 1771955..1772182 (+) | 228 | WP_063629755.1 | hypothetical protein | - |
| DQM47_RS09935 (NCTC10876_01816) | - | 1772196..1772366 (+) | 171 | WP_168388561.1 | hypothetical protein | - |
| DQM47_RS09145 (NCTC10876_01817) | - | 1772363..1772632 (+) | 270 | WP_109982045.1 | hypothetical protein | - |
| DQM47_RS09150 (NCTC10876_01818) | - | 1772635..1773384 (+) | 750 | WP_111685854.1 | DNA-methyltransferase | - |
| DQM47_RS09155 (NCTC10876_01819) | - | 1773432..1774178 (+) | 747 | WP_231907105.1 | DUF1642 domain-containing protein | - |
| DQM47_RS09160 (NCTC10876_01820) | - | 1774190..1774408 (+) | 219 | WP_111685855.1 | hypothetical protein | - |
| DQM47_RS09165 (NCTC10876_01821) | ssbA | 1774405..1774797 (+) | 393 | WP_032460876.1 | single-stranded DNA-binding protein | Machinery gene |
| DQM47_RS09170 (NCTC10876_01822) | - | 1774811..1775089 (+) | 279 | WP_029713970.1 | hypothetical protein | - |
| DQM47_RS09180 (NCTC10876_01824) | - | 1775184..1775411 (+) | 228 | WP_063629751.1 | hypothetical protein | - |
| DQM47_RS09185 (NCTC10876_01825) | - | 1775383..1775847 (+) | 465 | WP_063629750.1 | hypothetical protein | - |
| DQM47_RS09190 (NCTC10876_01826) | - | 1775957..1776499 (+) | 543 | WP_063629749.1 | site-specific integrase | - |
| DQM47_RS09195 (NCTC10876_01827) | - | 1776636..1776851 (+) | 216 | WP_227877423.1 | hypothetical protein | - |
| DQM47_RS10080 | - | 1777240..1777434 (+) | 195 | WP_227876734.1 | HNH endonuclease | - |
| DQM47_RS09205 (NCTC10876_01828) | - | 1777552..1778037 (+) | 486 | WP_000601034.1 | hypothetical protein | - |
| DQM47_RS09210 (NCTC10876_01829) | - | 1778030..1779742 (+) | 1713 | WP_111685857.1 | terminase TerL endonuclease subunit | - |
| DQM47_RS09215 (NCTC10876_01830) | - | 1779751..1780893 (+) | 1143 | WP_111685858.1 | phage portal protein | - |
| DQM47_RS09220 (NCTC10876_01831) | - | 1780944..1781486 (+) | 543 | WP_063629746.1 | HK97 family phage prohead protease | - |
| DQM47_RS09225 (NCTC10876_01832) | - | 1781497..1782759 (+) | 1263 | WP_063629745.1 | phage major capsid protein | - |
| DQM47_RS09230 (NCTC10876_01833) | - | 1782779..1783117 (+) | 339 | WP_032460894.1 | hypothetical protein | - |
| DQM47_RS09235 (NCTC10876_01834) | - | 1783114..1783419 (+) | 306 | WP_032460893.1 | head-tail adaptor protein | - |
| DQM47_RS09240 (NCTC10876_01835) | - | 1783419..1783766 (+) | 348 | WP_032460892.1 | hypothetical protein | - |
| DQM47_RS09245 (NCTC10876_01836) | - | 1783753..1784097 (+) | 345 | WP_063629744.1 | hypothetical protein | - |
| DQM47_RS09250 (NCTC10876_01837) | - | 1784112..1784783 (+) | 672 | WP_063629743.1 | phage tail protein | - |
| DQM47_RS09255 (NCTC10876_01838) | - | 1784787..1785260 (+) | 474 | WP_063629742.1 | hypothetical protein | - |
| DQM47_RS09265 (NCTC10876_01839) | - | 1785450..1788185 (+) | 2736 | WP_111685860.1 | phage tail tape measure protein | - |
| DQM47_RS09270 (NCTC10876_01840) | - | 1788182..1788904 (+) | 723 | WP_063629740.1 | hypothetical protein | - |
| DQM47_RS09275 (NCTC10876_01841) | - | 1788905..1790848 (+) | 1944 | WP_231907106.1 | phage tail spike protein | - |
| DQM47_RS09280 (NCTC10876_01842) | - | 1790845..1791960 (+) | 1116 | WP_063629043.1 | hyaluronoglucosaminidase | - |
| DQM47_RS09285 (NCTC10876_01843) | - | 1791975..1793756 (+) | 1782 | WP_111685861.1 | gp58-like family protein | - |
| DQM47_RS09290 (NCTC10876_01844) | - | 1793765..1794193 (+) | 429 | WP_111685862.1 | DUF1617 family protein | - |
| DQM47_RS09295 (NCTC10876_01845) | - | 1794196..1794834 (+) | 639 | WP_111685863.1 | hypothetical protein | - |
| DQM47_RS09300 (NCTC10876_01846) | - | 1794844..1795116 (+) | 273 | WP_111685864.1 | hypothetical protein | - |
| DQM47_RS09305 (NCTC10876_01847) | - | 1795113..1795340 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQM47_RS09310 (NCTC10876_01849) | - | 1795456..1796673 (+) | 1218 | WP_111685865.1 | peptidoglycan amidohydrolase family protein | - |
| DQM47_RS10190 (NCTC10876_01850) | prx | 1796838..1796999 (+) | 162 | WP_309543630.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6122.18 Da Isoelectric Point: 6.4475
>NTDB_id=1138493 DQM47_RS10190 WP_309543630.1 1796838..1796999(+) (prx) [Streptococcus pyogenes strain NCTC10876]
MLTYDEFKQAIDDGYITADTVAILAIFLKKILLKNSREFAHHLPTNFIIINQI
MLTYDEFKQAIDDGYITADTVAILAIFLKKILLKNSREFAHHLPTNFIIINQI
Nucleotide
Download Length: 162 bp
>NTDB_id=1138493 DQM47_RS10190 WP_309543630.1 1796838..1796999(+) (prx) [Streptococcus pyogenes strain NCTC10876]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACACAGTAGCGATCTTAGCTATTTT
TTTGAAAAAAATTCTCCTGAAGAACTCAAGAGAATTTGCCCACCATTTGCCCACCAACTTTATCATAATTAACCAAATTT
AA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACACAGTAGCGATCTTAGCTATTTT
TTTGAAAAAAATTCTCCTGAAGAACTCAAGAGAATTTGCCCACCATTTGCCCACCAACTTTATCATAATTAACCAAATTT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
61.364 |
83.019 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
61.364 |
83.019 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.25 |
90.566 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
50 |
83.019 |
0.415 |
| prx | Streptococcus pyogenes MGAS8232 |
83.333 |
45.283 |
0.377 |