Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL37_RS10045 | Genome accession | NZ_LS483352 |
| Coordinates | 1748044..1748205 (+) | Length | 53 a.a. |
| NCBI ID | WP_309543630.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12052 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1710461..1748205 | 1748044..1748205 | within | 0 |
Gene organization within MGE regions
Location: 1710461..1748205
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL37_RS08885 (NCTC12052_01753) | groL | 1710461..1712092 (-) | 1632 | WP_002982320.1 | chaperonin GroEL | - |
| DQL37_RS08890 (NCTC12052_01754) | groES | 1712128..1712418 (-) | 291 | WP_002991292.1 | co-chaperone GroES | - |
| DQL37_RS08895 (NCTC12052_01755) | clpC | 1712596..1715040 (-) | 2445 | WP_111685848.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
| DQL37_RS08900 (NCTC12052_01756) | - | 1715040..1715501 (-) | 462 | WP_002982312.1 | CtsR family transcriptional regulator | - |
| DQL37_RS08905 | - | 1715697..1715900 (-) | 204 | WP_002991299.1 | cold-shock protein | - |
| DQL37_RS08910 (NCTC12052_01758) | - | 1716499..1717569 (-) | 1071 | WP_063629765.1 | tyrosine-type recombinase/integrase | - |
| DQL37_RS08915 (NCTC12052_01759) | - | 1717697..1717999 (-) | 303 | WP_111685849.1 | hypothetical protein | - |
| DQL37_RS08920 (NCTC12052_01760) | - | 1717992..1718378 (-) | 387 | WP_063629763.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL37_RS08925 (NCTC12052_01761) | - | 1718382..1718732 (-) | 351 | WP_063629762.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS08935 (NCTC12052_01762) | - | 1719129..1719338 (+) | 210 | WP_111685850.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS08940 (NCTC12052_01763) | - | 1719338..1719700 (+) | 363 | WP_063629760.1 | hypothetical protein | - |
| DQL37_RS08945 (NCTC12052_01764) | - | 1719722..1720006 (+) | 285 | WP_063629759.1 | hypothetical protein | - |
| DQL37_RS08950 (NCTC12052_01765) | - | 1720033..1720251 (+) | 219 | WP_063629758.1 | hypothetical protein | - |
| DQL37_RS08955 (NCTC12052_01766) | dnaB | 1720260..1721606 (+) | 1347 | WP_111685851.1 | replicative DNA helicase | - |
| DQL37_RS08960 (NCTC12052_01767) | - | 1721593..1722339 (+) | 747 | WP_111685852.1 | conserved phage C-terminal domain-containing protein | - |
| DQL37_RS08965 (NCTC12052_01768) | - | 1722340..1723161 (+) | 822 | WP_111685853.1 | ATP-binding protein | - |
| DQL37_RS08970 (NCTC12052_01769) | - | 1723161..1723388 (+) | 228 | WP_063629755.1 | hypothetical protein | - |
| DQL37_RS09770 (NCTC12052_01770) | - | 1723402..1723572 (+) | 171 | WP_168388561.1 | hypothetical protein | - |
| DQL37_RS08975 (NCTC12052_01771) | - | 1723569..1723838 (+) | 270 | WP_109982045.1 | hypothetical protein | - |
| DQL37_RS08980 (NCTC12052_01772) | - | 1723841..1724590 (+) | 750 | WP_111685854.1 | DNA-methyltransferase | - |
| DQL37_RS08985 (NCTC12052_01773) | - | 1724638..1725384 (+) | 747 | WP_231907105.1 | DUF1642 domain-containing protein | - |
| DQL37_RS08990 (NCTC12052_01774) | - | 1725396..1725614 (+) | 219 | WP_111685855.1 | hypothetical protein | - |
| DQL37_RS08995 (NCTC12052_01775) | ssbA | 1725611..1726003 (+) | 393 | WP_032460876.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL37_RS09000 (NCTC12052_01776) | - | 1726017..1726295 (+) | 279 | WP_029713970.1 | hypothetical protein | - |
| DQL37_RS09010 (NCTC12052_01778) | - | 1726390..1726617 (+) | 228 | WP_063629751.1 | hypothetical protein | - |
| DQL37_RS09015 (NCTC12052_01779) | - | 1726589..1727053 (+) | 465 | WP_063629750.1 | hypothetical protein | - |
| DQL37_RS09020 (NCTC12052_01780) | - | 1727163..1727705 (+) | 543 | WP_063629749.1 | site-specific integrase | - |
| DQL37_RS09025 (NCTC12052_01781) | - | 1727875..1728057 (+) | 183 | WP_063629748.1 | hypothetical protein | - |
| DQL37_RS09920 | - | 1728446..1728640 (+) | 195 | WP_227876734.1 | HNH endonuclease | - |
| DQL37_RS09035 (NCTC12052_01782) | - | 1728758..1729243 (+) | 486 | WP_000601034.1 | hypothetical protein | - |
| DQL37_RS09040 (NCTC12052_01783) | - | 1729236..1730948 (+) | 1713 | WP_111685857.1 | terminase TerL endonuclease subunit | - |
| DQL37_RS09045 (NCTC12052_01784) | - | 1730957..1732099 (+) | 1143 | WP_111685858.1 | phage portal protein | - |
| DQL37_RS09050 (NCTC12052_01785) | - | 1732150..1732692 (+) | 543 | WP_063629746.1 | HK97 family phage prohead protease | - |
| DQL37_RS09055 (NCTC12052_01786) | - | 1732703..1733965 (+) | 1263 | WP_063629745.1 | phage major capsid protein | - |
| DQL37_RS09060 (NCTC12052_01787) | - | 1733985..1734323 (+) | 339 | WP_032460894.1 | hypothetical protein | - |
| DQL37_RS09065 (NCTC12052_01788) | - | 1734320..1734625 (+) | 306 | WP_032460893.1 | head-tail adaptor protein | - |
| DQL37_RS09070 (NCTC12052_01789) | - | 1734625..1734972 (+) | 348 | WP_032460892.1 | hypothetical protein | - |
| DQL37_RS09075 (NCTC12052_01790) | - | 1734959..1735303 (+) | 345 | WP_063629744.1 | hypothetical protein | - |
| DQL37_RS09080 (NCTC12052_01791) | - | 1735318..1735989 (+) | 672 | WP_063629743.1 | phage tail protein | - |
| DQL37_RS09085 (NCTC12052_01792) | - | 1735993..1736466 (+) | 474 | WP_063629742.1 | hypothetical protein | - |
| DQL37_RS09095 (NCTC12052_01793) | - | 1736656..1739391 (+) | 2736 | WP_111685860.1 | phage tail tape measure protein | - |
| DQL37_RS09100 (NCTC12052_01794) | - | 1739388..1740110 (+) | 723 | WP_063629740.1 | hypothetical protein | - |
| DQL37_RS09105 (NCTC12052_01795) | - | 1740111..1742054 (+) | 1944 | WP_231907106.1 | phage tail spike protein | - |
| DQL37_RS09110 (NCTC12052_01796) | - | 1742051..1743166 (+) | 1116 | WP_063629043.1 | hyaluronoglucosaminidase | - |
| DQL37_RS09115 (NCTC12052_01797) | - | 1743181..1744962 (+) | 1782 | WP_111685861.1 | gp58-like family protein | - |
| DQL37_RS09120 (NCTC12052_01798) | - | 1744971..1745399 (+) | 429 | WP_111685862.1 | DUF1617 family protein | - |
| DQL37_RS09125 (NCTC12052_01799) | - | 1745402..1746040 (+) | 639 | WP_111685863.1 | hypothetical protein | - |
| DQL37_RS09130 (NCTC12052_01800) | - | 1746050..1746322 (+) | 273 | WP_111685864.1 | hypothetical protein | - |
| DQL37_RS09135 (NCTC12052_01801) | - | 1746319..1746546 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQL37_RS09140 (NCTC12052_01803) | - | 1746662..1747879 (+) | 1218 | WP_111685865.1 | peptidoglycan amidohydrolase family protein | - |
| DQL37_RS10045 (NCTC12052_01804) | prx | 1748044..1748205 (+) | 162 | WP_309543630.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6122.18 Da Isoelectric Point: 6.4475
>NTDB_id=1138076 DQL37_RS10045 WP_309543630.1 1748044..1748205(+) (prx) [Streptococcus pyogenes strain NCTC12052]
MLTYDEFKQAIDDGYITADTVAILAIFLKKILLKNSREFAHHLPTNFIIINQI
MLTYDEFKQAIDDGYITADTVAILAIFLKKILLKNSREFAHHLPTNFIIINQI
Nucleotide
Download Length: 162 bp
>NTDB_id=1138076 DQL37_RS10045 WP_309543630.1 1748044..1748205(+) (prx) [Streptococcus pyogenes strain NCTC12052]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACACAGTAGCGATCTTAGCTATTTT
TTTGAAAAAAATTCTCCTGAAGAACTCAAGAGAATTTGCCCACCATTTGCCCACCAACTTTATCATAATTAACCAAATTT
AA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACACAGTAGCGATCTTAGCTATTTT
TTTGAAAAAAATTCTCCTGAAGAACTCAAGAGAATTTGCCCACCATTTGCCCACCAACTTTATCATAATTAACCAAATTT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
61.364 |
83.019 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
61.364 |
83.019 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.25 |
90.566 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
50 |
83.019 |
0.415 |
| prx | Streptococcus pyogenes MGAS8232 |
83.333 |
45.283 |
0.377 |