Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | FGK91_RS06460 | Genome accession | NZ_LR590483 |
| Coordinates | 1269681..1269863 (-) | Length | 60 a.a. |
| NCBI ID | WP_111703187.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8318 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1269681..1306158 | 1269681..1269863 | within | 0 |
Gene organization within MGE regions
Location: 1269681..1306158
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGK91_RS06460 (NCTC8318_01290) | prx | 1269681..1269863 (-) | 183 | WP_111703187.1 | Paratox | Regulator |
| FGK91_RS06465 (NCTC8318_01291) | speA | 1270084..1270839 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| FGK91_RS06470 (NCTC8318_01292) | - | 1270961..1271620 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| FGK91_RS06475 (NCTC8318_01293) | - | 1271620..1271841 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| FGK91_RS06480 (NCTC8318_01294) | - | 1271851..1272624 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| FGK91_RS06485 (NCTC8318_01295) | - | 1272635..1273237 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| FGK91_RS06490 (NCTC8318_01296) | - | 1273249..1274013 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| FGK91_RS06495 (NCTC8318_01297) | - | 1274015..1274347 (-) | 333 | WP_011054798.1 | phage holin | - |
| FGK91_RS06500 (NCTC8318_01298) | - | 1274347..1274670 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| FGK91_RS09525 (NCTC8318_01299) | - | 1274684..1274806 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| FGK91_RS06505 (NCTC8318_01300) | - | 1274820..1275167 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| FGK91_RS06510 (NCTC8318_01301) | - | 1275178..1277040 (-) | 1863 | WP_009880248.1 | DUF859 family phage minor structural protein | - |
| FGK91_RS06515 (NCTC8318_01302) | - | 1277045..1280485 (-) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| FGK91_RS06520 (NCTC8318_01303) | - | 1280486..1281970 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| FGK91_RS06525 (NCTC8318_01304) | - | 1281971..1283776 (-) | 1806 | WP_011054802.1 | tail protein | - |
| FGK91_RS06530 (NCTC8318_01305) | - | 1283769..1284227 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| FGK91_RS06535 (NCTC8318_01306) | - | 1284200..1284517 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| FGK91_RS06540 (NCTC8318_01307) | - | 1284530..1285036 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| FGK91_RS06545 (NCTC8318_01308) | - | 1285048..1285458 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| FGK91_RS06550 (NCTC8318_01309) | - | 1285460..1285855 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| FGK91_RS06555 (NCTC8318_01310) | - | 1285852..1286163 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| FGK91_RS06560 (NCTC8318_01311) | - | 1286160..1286504 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| FGK91_RS06565 (NCTC8318_01312) | - | 1286518..1286811 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| FGK91_RS06570 (NCTC8318_01313) | - | 1286823..1287713 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| FGK91_RS06575 (NCTC8318_01314) | - | 1287731..1288300 (-) | 570 | WP_146710355.1 | DUF4355 domain-containing protein | - |
| FGK91_RS06580 (NCTC8318_01315) | - | 1288450..1288716 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| FGK91_RS06585 (NCTC8318_01316) | - | 1288723..1289631 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| FGK91_RS06590 (NCTC8318_01317) | - | 1289600..1290925 (-) | 1326 | WP_009880265.1 | phage portal protein | - |
| FGK91_RS06595 (NCTC8318_01318) | - | 1290925..1292199 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| FGK91_RS06600 (NCTC8318_01319) | - | 1292189..1292569 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| FGK91_RS06605 (NCTC8318_01320) | - | 1292913..1293353 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FGK91_RS06610 (NCTC8318_01321) | - | 1293626..1294261 (-) | 636 | WP_021340848.1 | N-6 DNA methylase | - |
| FGK91_RS06615 (NCTC8318_01322) | - | 1294261..1294662 (-) | 402 | WP_002987468.1 | hypothetical protein | - |
| FGK91_RS06620 (NCTC8318_01323) | - | 1294760..1294987 (-) | 228 | WP_146710356.1 | hypothetical protein | - |
| FGK91_RS06625 (NCTC8318_01324) | - | 1295000..1295674 (-) | 675 | WP_003057298.1 | DNA methyltransferase | - |
| FGK91_RS06630 (NCTC8318_01325) | - | 1295671..1295955 (-) | 285 | WP_136105806.1 | hypothetical protein | - |
| FGK91_RS06635 (NCTC8318_01326) | - | 1295952..1296386 (-) | 435 | WP_146710357.1 | YopX family protein | - |
| FGK91_RS06640 (NCTC8318_01327) | - | 1296370..1296657 (-) | 288 | WP_146710378.1 | nucleotide modification associated domain-containing protein | - |
| FGK91_RS06645 (NCTC8318_01328) | - | 1296711..1297067 (-) | 357 | WP_146710358.1 | hypothetical protein | - |
| FGK91_RS06650 (NCTC8318_01329) | - | 1297064..1297504 (-) | 441 | WP_146710359.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FGK91_RS06655 (NCTC8318_01330) | - | 1297504..1297710 (-) | 207 | WP_146710360.1 | hypothetical protein | - |
| FGK91_RS06660 (NCTC8318_01331) | ssbA | 1297723..1298148 (-) | 426 | WP_146710361.1 | single-stranded DNA-binding protein | Machinery gene |
| FGK91_RS06665 (NCTC8318_01332) | - | 1298141..1298815 (-) | 675 | WP_146710362.1 | ERF family protein | - |
| FGK91_RS06670 (NCTC8318_01333) | - | 1298816..1299298 (-) | 483 | WP_146710363.1 | siphovirus Gp157 family protein | - |
| FGK91_RS06675 (NCTC8318_01334) | - | 1299320..1299574 (-) | 255 | WP_146710364.1 | hypothetical protein | - |
| FGK91_RS06680 (NCTC8318_01335) | - | 1299567..1299911 (-) | 345 | WP_146710365.1 | HTH domain-containing protein | - |
| FGK91_RS09315 (NCTC8318_01336) | - | 1299922..1300059 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| FGK91_RS06685 (NCTC8318_01337) | - | 1300059..1300901 (-) | 843 | WP_063629027.1 | ATP-binding protein | - |
| FGK91_RS06690 (NCTC8318_01338) | - | 1300911..1301813 (-) | 903 | WP_085613680.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FGK91_RS06695 (NCTC8318_01339) | - | 1301827..1302144 (-) | 318 | WP_111703179.1 | helix-turn-helix transcriptional regulator | - |
| FGK91_RS09530 (NCTC8318_01340) | - | 1302160..1302294 (-) | 135 | WP_011528543.1 | hypothetical protein | - |
| FGK91_RS06700 (NCTC8318_01341) | - | 1302325..1302576 (-) | 252 | WP_011528542.1 | hypothetical protein | - |
| FGK91_RS06705 (NCTC8318_01342) | - | 1302671..1302889 (-) | 219 | WP_009881062.1 | helix-turn-helix transcriptional regulator | - |
| FGK91_RS06710 (NCTC8318_01343) | - | 1303078..1303437 (+) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| FGK91_RS06715 (NCTC8318_01344) | - | 1303421..1303798 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FGK91_RS09320 (NCTC8318_01345) | - | 1303809..1303961 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| FGK91_RS06720 (NCTC8318_01346) | - | 1304132..1304818 (+) | 687 | WP_043885029.1 | hypothetical protein | - |
| FGK91_RS06725 (NCTC8318_01347) | - | 1304992..1306158 (+) | 1167 | WP_009880742.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6951.96 Da Isoelectric Point: 4.2336
>NTDB_id=1127055 FGK91_RS06460 WP_111703187.1 1269681..1269863(-) (prx) [Streptococcus pyogenes strain NCTC8318]
MLYIDEFKEAIDKGDILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEDVMVELDK
MLYIDEFKEAIDKGDILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEDVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1127055 FGK91_RS06460 WP_111703187.1 1269681..1269863(-) (prx) [Streptococcus pyogenes strain NCTC8318]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGGATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGACG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGGATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGACG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
96.667 |
100 |
0.967 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS8232 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |