Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | EW031_RS11280 | Genome accession | NZ_LR130518 |
| Coordinates | 2133541..2134011 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain BPH2986 isolate BPH2986 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2103841..2159790 | 2133541..2134011 | within | 0 |
Gene organization within MGE regions
Location: 2103841..2159790
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW031_RS11060 | scn | 2103841..2104191 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| EW031_RS11065 | - | 2104876..2105325 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| EW031_RS11070 | - | 2105420..2105758 (-) | 339 | Protein_2051 | SH3 domain-containing protein | - |
| EW031_RS11080 | sak | 2106405..2106896 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| EW031_RS11085 | - | 2107087..2107842 (-) | 756 | WP_129790285.1 | CHAP domain-containing protein | - |
| EW031_RS11090 | - | 2107854..2108108 (-) | 255 | WP_000611512.1 | phage holin | - |
| EW031_RS11095 | - | 2108160..2108267 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| EW031_RS11100 | pepG1 | 2108320..2108454 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| EW031_RS11105 | - | 2108646..2108942 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| EW031_RS11110 | - | 2109000..2109287 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| EW031_RS11115 | - | 2109334..2109486 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| EW031_RS11120 | - | 2109476..2113261 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| EW031_RS11125 | - | 2113277..2114761 (-) | 1485 | WP_000567394.1 | phage distal tail protein | - |
| EW031_RS11130 | - | 2114758..2119287 (-) | 4530 | WP_031925447.1 | phage tail tape measure protein | - |
| EW031_RS15765 | gpGT | 2119344..2119481 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| EW031_RS11135 | gpG | 2119532..2119882 (-) | 351 | WP_001096354.1 | phage tail assembly chaperone G | - |
| EW031_RS11140 | - | 2119932..2120171 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| EW031_RS11145 | - | 2120198..2120842 (-) | 645 | WP_000260578.1 | major tail protein | - |
| EW031_RS11150 | - | 2120846..2121250 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| EW031_RS11155 | - | 2121247..2121651 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| EW031_RS11160 | - | 2121648..2122010 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| EW031_RS11165 | - | 2121994..2122278 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| EW031_RS11170 | - | 2122268..2122552 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| EW031_RS11175 | - | 2122572..2123717 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| EW031_RS11180 | - | 2123741..2124478 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| EW031_RS11185 | - | 2124462..2125649 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| EW031_RS11190 | - | 2125665..2127326 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| EW031_RS11195 | - | 2127323..2127667 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| EW031_RS11200 | - | 2127797..2128096 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| EW031_RS11205 | - | 2128328..2128744 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| EW031_RS11210 | - | 2128772..2128972 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| EW031_RS11215 | rinB | 2128972..2129121 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| EW031_RS11220 | - | 2129118..2129504 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| EW031_RS11225 | - | 2129501..2129707 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| EW031_RS11230 | - | 2129704..2129949 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| EW031_RS11235 | - | 2129986..2130519 (-) | 534 | WP_000181819.1 | dUTP diphosphatase | - |
| EW031_RS11240 | - | 2130512..2130754 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| EW031_RS11245 | - | 2130744..2130980 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| EW031_RS11250 | - | 2130973..2131344 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| EW031_RS11255 | - | 2131353..2131595 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| EW031_RS11260 | - | 2131599..2131967 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| EW031_RS11265 | - | 2131980..2132384 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EW031_RS11270 | - | 2132393..2132611 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| EW031_RS11275 | - | 2132618..2133511 (-) | 894 | WP_000148333.1 | DnaD domain protein | - |
| EW031_RS11280 | ssbA | 2133541..2134011 (-) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| EW031_RS11285 | - | 2134012..2134629 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| EW031_RS11290 | - | 2134710..2135630 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| EW031_RS11295 | - | 2135632..2137575 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| EW031_RS11300 | - | 2137584..2137847 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| EW031_RS11305 | - | 2137856..2138116 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| EW031_RS11310 | - | 2138156..2138416 (-) | 261 | WP_001549178.1 | DUF2482 family protein | - |
| EW031_RS11315 | - | 2138511..2138672 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| EW031_RS11320 | - | 2138669..2138989 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| EW031_RS11325 | - | 2139048..2139278 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| EW031_RS15595 | - | 2139275..2139451 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| EW031_RS11330 | - | 2139467..2140219 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| EW031_RS11335 | - | 2140270..2140599 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| EW031_RS11340 | - | 2140588..2140803 (-) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| EW031_RS11345 | - | 2140819..2141082 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| EW031_RS11350 | - | 2141079..2141253 (-) | 175 | Protein_2108 | transcriptional regulator | - |
| EW031_RS11355 | - | 2141216..2141929 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| EW031_RS11360 | - | 2141945..2142877 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| EW031_RS11365 | - | 2142883..2143224 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| EW031_RS11370 | - | 2143428..2143610 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| EW031_RS11375 | - | 2143688..2144401 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| EW031_RS11380 | - | 2144592..2145629 (+) | 1038 | WP_000857199.1 | tyrosine-type recombinase/integrase | - |
| EW031_RS11385 | sph | 2145686..2146510 (+) | 825 | Protein_2115 | sphingomyelin phosphodiesterase | - |
| EW031_RS11390 | lukG | 2146748..2147764 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| EW031_RS11395 | lukH | 2147786..2148841 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| EW031_RS11400 | - | 2149276..2150499 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| EW031_RS11405 | - | 2150871..2151716 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| EW031_RS11410 | - | 2151778..2152689 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| EW031_RS11415 | - | 2152850..2154157 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| EW031_RS11425 | - | 2155010..2155453 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| EW031_RS11430 | - | 2155559..2155995 (-) | 437 | Protein_2123 | hypothetical protein | - |
| EW031_RS11435 | - | 2156313..2156903 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| EW031_RS11440 | - | 2156900..2157112 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| EW031_RS11445 | - | 2157173..2157719 (+) | 547 | Protein_2126 | site-specific integrase | - |
| EW031_RS11450 | groL | 2157814..2159430 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| EW031_RS11455 | groES | 2159506..2159790 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=1116964 EW031_RS11280 WP_000934753.1 2133541..2134011(-) (ssbA) [Staphylococcus aureus strain BPH2986 isolate BPH2986]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1116964 EW031_RS11280 WP_000934753.1 2133541..2134011(-) (ssbA) [Staphylococcus aureus strain BPH2986 isolate BPH2986]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |