Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | B6D67_RS07220 | Genome accession | NZ_LN831034 |
| Coordinates | 1360938..1361120 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8198 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1360938..1402151 | 1360938..1361120 | within | 0 |
Gene organization within MGE regions
Location: 1360938..1402151
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B6D67_RS07220 (ERS445054_01442) | prx | 1360938..1361120 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| B6D67_RS07225 (ERS445054_01443) | sda3 | 1361358..1362158 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| B6D67_RS07230 (ERS445054_01444) | - | 1362431..1362865 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| B6D67_RS10435 | - | 1362915..1363325 (-) | 411 | WP_228549912.1 | hypothetical protein | - |
| B6D67_RS10440 (ERS445054_01445) | - | 1363473..1363781 (-) | 309 | WP_228549913.1 | hypothetical protein | - |
| B6D67_RS07240 (ERS445054_01446) | - | 1363769..1364293 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| B6D67_RS07245 (ERS445054_01447) | - | 1364433..1365638 (-) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| B6D67_RS10530 (ERS445054_01448) | - | 1365626..1365748 (-) | 123 | WP_029713948.1 | hypothetical protein | - |
| B6D67_RS07250 (ERS445054_01449) | - | 1365750..1366205 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| B6D67_RS07255 (ERS445054_01450) | - | 1366215..1366847 (-) | 633 | WP_011888699.1 | hypothetical protein | - |
| B6D67_RS07260 (ERS445054_01451) | - | 1366850..1367281 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| B6D67_RS07265 (ERS445054_01452) | - | 1367293..1369179 (-) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| B6D67_RS07270 (ERS445054_01453) | - | 1369192..1370202 (-) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| B6D67_RS07275 (ERS445054_01454) | - | 1370199..1372343 (-) | 2145 | WP_014635605.1 | phage tail spike protein | - |
| B6D67_RS07280 (ERS445054_01455) | - | 1372340..1373056 (-) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| B6D67_RS07285 (ERS445054_01456) | - | 1373053..1376313 (-) | 3261 | WP_029714384.1 | tape measure protein | - |
| B6D67_RS07290 (ERS445054_01457) | - | 1376303..1376884 (-) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| B6D67_RS07295 (ERS445054_01458) | - | 1376888..1377322 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| B6D67_RS07300 (ERS445054_01459) | - | 1377366..1377827 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| B6D67_RS07305 (ERS445054_01460) | - | 1377827..1378225 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| B6D67_RS07310 (ERS445054_01461) | - | 1378222..1378578 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| B6D67_RS07315 (ERS445054_01462) | - | 1378578..1378910 (-) | 333 | WP_011888693.1 | minor capsid protein | - |
| B6D67_RS07320 (ERS445054_01463) | - | 1378900..1379316 (-) | 417 | WP_011888692.1 | hypothetical protein | - |
| B6D67_RS07325 (ERS445054_01464) | - | 1379370..1380188 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| B6D67_RS07330 (ERS445054_01465) | - | 1380192..1380806 (-) | 615 | WP_011888690.1 | hypothetical protein | - |
| B6D67_RS07335 (ERS445054_01466) | - | 1380932..1381198 (-) | 267 | WP_011888689.1 | hypothetical protein | - |
| B6D67_RS07340 (ERS445054_01467) | - | 1381285..1381512 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| B6D67_RS07345 (ERS445054_01468) | - | 1381512..1383005 (-) | 1494 | WP_029714379.1 | phage minor capsid protein | - |
| B6D67_RS07350 (ERS445054_01469) | - | 1383010..1384512 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| B6D67_RS07355 (ERS445054_01470) | - | 1384526..1385817 (-) | 1292 | Protein_1396 | PBSX family phage terminase large subunit | - |
| B6D67_RS07360 (ERS445054_01471) | - | 1385820..1386296 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| B6D67_RS07365 (ERS445054_01473) | - | 1386639..1387805 (-) | 1167 | Protein_1398 | DNA modification methylase | - |
| B6D67_RS07380 (ERS445054_01474) | - | 1388439..1388873 (-) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| B6D67_RS10280 (ERS445054_01475) | - | 1389157..1389327 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| B6D67_RS07385 (ERS445054_01476) | - | 1389324..1389803 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| B6D67_RS07390 (ERS445054_01477) | - | 1389808..1390440 (-) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| B6D67_RS07395 (ERS445054_01478) | - | 1390442..1390726 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| B6D67_RS10285 (ERS445054_01479) | - | 1390723..1390893 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| B6D67_RS07400 (ERS445054_01480) | - | 1390890..1391126 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| B6D67_RS10555 (ERS445054_01481) | - | 1391126..1391371 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| B6D67_RS07410 (ERS445054_01482) | - | 1391368..1391724 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| B6D67_RS07415 (ERS445054_01483) | - | 1391721..1392161 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| B6D67_RS07420 | - | 1392161..1392364 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| B6D67_RS07425 (ERS445054_01484) | ssb | 1392370..1392795 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| B6D67_RS07430 (ERS445054_01485) | - | 1392788..1393462 (-) | 675 | WP_029714396.1 | ERF family protein | - |
| B6D67_RS07435 (ERS445054_01486) | - | 1393463..1393945 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| B6D67_RS07440 (ERS445054_01487) | - | 1393967..1394221 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| B6D67_RS07445 (ERS445054_01488) | - | 1394202..1394555 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| B6D67_RS07450 (ERS445054_01490) | - | 1394696..1395478 (-) | 783 | WP_011888684.1 | ATP-binding protein | - |
| B6D67_RS07455 (ERS445054_01491) | - | 1395465..1396226 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| B6D67_RS07460 (ERS445054_01493) | - | 1396320..1396457 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| B6D67_RS07465 (ERS445054_01494) | - | 1396488..1396739 (-) | 252 | WP_011888682.1 | helix-turn-helix transcriptional regulator | - |
| B6D67_RS07470 (ERS445054_01495) | - | 1396810..1396995 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| B6D67_RS07475 (ERS445054_01496) | - | 1397162..1397401 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| B6D67_RS07480 (ERS445054_01497) | - | 1397499..1398218 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| B6D67_RS07485 (ERS445054_01498) | - | 1398246..1398458 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| B6D67_RS07490 (ERS445054_01499) | - | 1398656..1398997 (+) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| B6D67_RS07495 (ERS445054_01500) | - | 1398981..1399367 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| B6D67_RS07500 (ERS445054_01501) | - | 1399382..1400803 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| B6D67_RS07505 (ERS445054_01502) | - | 1400985..1402151 (+) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=1114240 B6D67_RS07220 WP_011184907.1 1360938..1361120(-) (prx) [Streptococcus pyogenes strain NCTC8198]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1114240 B6D67_RS07220 WP_011184907.1 1360938..1361120(-) (prx) [Streptococcus pyogenes strain NCTC8198]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |