Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACI3ES_RS08245 | Genome accession | NZ_CP174386 |
| Coordinates | 1655019..1655465 (-) | Length | 148 a.a. |
| NCBI ID | WP_114667516.1 | Uniprot ID | - |
| Organism | Leuconostoc falkenbergense strain SAEED 24451 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1623129..1662822 | 1655019..1655465 | within | 0 |
Gene organization within MGE regions
Location: 1623129..1662822
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACI3ES_RS08015 | - | 1623129..1623329 (-) | 201 | WP_114667104.1 | cold-shock protein | - |
| ACI3ES_RS08020 | - | 1623600..1623755 (-) | 156 | WP_181809846.1 | hypothetical protein | - |
| ACI3ES_RS08025 | - | 1623765..1624664 (-) | 900 | WP_142511783.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ACI3ES_RS08030 | - | 1624661..1625125 (-) | 465 | WP_114667106.1 | phage holin family protein | - |
| ACI3ES_RS08035 | - | 1625130..1625366 (-) | 237 | WP_142511782.1 | hypothetical protein | - |
| ACI3ES_RS08040 | - | 1625369..1625497 (-) | 129 | WP_258552057.1 | hypothetical protein | - |
| ACI3ES_RS08045 | - | 1625499..1631096 (-) | 5598 | WP_407631965.1 | phage tail spike protein | - |
| ACI3ES_RS08050 | - | 1631093..1631899 (-) | 807 | WP_317211282.1 | distal tail protein Dit | - |
| ACI3ES_RS08055 | - | 1631918..1633342 (-) | 1425 | WP_407631966.1 | hypothetical protein | - |
| ACI3ES_RS08060 | - | 1633384..1635192 (-) | 1809 | WP_242029690.1 | tape measure protein | - |
| ACI3ES_RS08065 | - | 1635193..1635525 (-) | 333 | WP_242029689.1 | hypothetical protein | - |
| ACI3ES_RS08070 | - | 1635621..1635959 (-) | 339 | WP_004912507.1 | tail assembly chaperone | - |
| ACI3ES_RS08075 | - | 1636013..1636597 (-) | 585 | WP_188353846.1 | phage major tail protein, TP901-1 family | - |
| ACI3ES_RS08080 | - | 1636611..1637006 (-) | 396 | WP_142511778.1 | DUF3168 domain-containing protein | - |
| ACI3ES_RS08085 | - | 1637003..1637362 (-) | 360 | WP_188353845.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACI3ES_RS08090 | - | 1637355..1637666 (-) | 312 | WP_142511776.1 | hypothetical protein | - |
| ACI3ES_RS08095 | - | 1637675..1638013 (-) | 339 | WP_114667753.1 | phage head-tail connector protein | - |
| ACI3ES_RS08100 | - | 1638077..1638337 (-) | 261 | WP_242029688.1 | Ig-like domain-containing protein | - |
| ACI3ES_RS08105 | - | 1638330..1639160 (-) | 831 | WP_142511775.1 | N4-gp56 family major capsid protein | - |
| ACI3ES_RS08110 | - | 1639165..1639758 (-) | 594 | WP_142511774.1 | DUF4355 domain-containing protein | - |
| ACI3ES_RS08115 | - | 1639927..1640865 (-) | 939 | WP_142511773.1 | minor capsid protein | - |
| ACI3ES_RS08120 | - | 1640846..1642351 (-) | 1506 | WP_188353844.1 | phage portal protein | - |
| ACI3ES_RS08125 | - | 1642362..1643654 (-) | 1293 | WP_142511771.1 | PBSX family phage terminase large subunit | - |
| ACI3ES_RS08130 | - | 1643644..1644405 (-) | 762 | WP_114667537.1 | terminase small subunit | - |
| ACI3ES_RS08135 | - | 1644441..1644836 (-) | 396 | WP_114667536.1 | hypothetical protein | - |
| ACI3ES_RS08140 | - | 1644967..1645602 (-) | 636 | WP_114667535.1 | hypothetical protein | - |
| ACI3ES_RS08145 | - | 1645655..1645834 (-) | 180 | WP_114667534.1 | hypothetical protein | - |
| ACI3ES_RS08150 | - | 1645831..1646037 (-) | 207 | WP_114667533.1 | hypothetical protein | - |
| ACI3ES_RS08155 | - | 1646048..1647259 (-) | 1212 | WP_142511770.1 | helix-turn-helix domain-containing protein | - |
| ACI3ES_RS08160 | - | 1647259..1647429 (-) | 171 | WP_185912988.1 | hypothetical protein | - |
| ACI3ES_RS08165 | - | 1647750..1647938 (-) | 189 | WP_114667531.1 | hypothetical protein | - |
| ACI3ES_RS08170 | - | 1648299..1648748 (-) | 450 | WP_242029685.1 | hypothetical protein | - |
| ACI3ES_RS08175 | - | 1649099..1649497 (-) | 399 | WP_407631967.1 | hypothetical protein | - |
| ACI3ES_RS08180 | - | 1649876..1650238 (-) | 363 | WP_242029683.1 | YopX family protein | - |
| ACI3ES_RS08185 | - | 1650241..1650528 (-) | 288 | WP_114667527.1 | hypothetical protein | - |
| ACI3ES_RS08190 | - | 1650525..1650725 (-) | 201 | WP_114667526.1 | hypothetical protein | - |
| ACI3ES_RS08195 | - | 1650722..1651003 (-) | 282 | WP_114667525.1 | hypothetical protein | - |
| ACI3ES_RS08200 | - | 1651008..1651166 (-) | 159 | WP_188353843.1 | hypothetical protein | - |
| ACI3ES_RS08205 | - | 1651135..1651596 (-) | 462 | WP_114667523.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACI3ES_RS08210 | - | 1651593..1652006 (-) | 414 | WP_142511416.1 | hypothetical protein | - |
| ACI3ES_RS08215 | - | 1652116..1652319 (-) | 204 | WP_114667522.1 | hypothetical protein | - |
| ACI3ES_RS08220 | - | 1652322..1653023 (-) | 702 | WP_114667520.1 | putative HNHc nuclease | - |
| ACI3ES_RS08225 | - | 1653028..1653213 (-) | 186 | WP_114667519.1 | helix-turn-helix domain-containing protein | - |
| ACI3ES_RS08230 | - | 1653650..1653916 (-) | 267 | WP_142511415.1 | hypothetical protein | - |
| ACI3ES_RS08235 | - | 1653886..1654686 (-) | 801 | WP_142511414.1 | helix-turn-helix domain-containing protein | - |
| ACI3ES_RS08240 | - | 1654702..1655007 (-) | 306 | WP_114667517.1 | hypothetical protein | - |
| ACI3ES_RS08245 | ssb | 1655019..1655465 (-) | 447 | WP_114667516.1 | single-stranded DNA-binding protein | Machinery gene |
| ACI3ES_RS08250 | - | 1655465..1656094 (-) | 630 | WP_242029681.1 | ERF family protein | - |
| ACI3ES_RS08255 | - | 1656094..1656999 (-) | 906 | Protein_1601 | DUF1351 domain-containing protein | - |
| ACI3ES_RS08260 | - | 1657002..1657211 (-) | 210 | WP_142511412.1 | hypothetical protein | - |
| ACI3ES_RS08265 | - | 1657208..1657405 (-) | 198 | WP_114667510.1 | helix-turn-helix transcriptional regulator | - |
| ACI3ES_RS08270 | - | 1657514..1657669 (-) | 156 | WP_181809872.1 | hypothetical protein | - |
| ACI3ES_RS08275 | - | 1657671..1657838 (-) | 168 | WP_181809871.1 | hypothetical protein | - |
| ACI3ES_RS08280 | - | 1657848..1658579 (-) | 732 | WP_142511411.1 | phage antirepressor KilAC domain-containing protein | - |
| ACI3ES_RS08285 | - | 1658585..1658827 (-) | 243 | WP_114667506.1 | hypothetical protein | - |
| ACI3ES_RS08290 | - | 1658909..1659064 (-) | 156 | WP_407631968.1 | hypothetical protein | - |
| ACI3ES_RS08295 | - | 1659065..1659523 (-) | 459 | WP_142511410.1 | DNA N-6-adenine-methyltransferase | - |
| ACI3ES_RS08300 | - | 1659516..1659725 (-) | 210 | WP_114667503.1 | hypothetical protein | - |
| ACI3ES_RS08305 | - | 1659791..1660018 (-) | 228 | WP_407631969.1 | helix-turn-helix transcriptional regulator | - |
| ACI3ES_RS08310 | - | 1660171..1660857 (+) | 687 | WP_114667500.1 | XRE family transcriptional regulator | - |
| ACI3ES_RS08315 | - | 1660923..1661477 (+) | 555 | WP_114667498.1 | Ltp family lipoprotein | - |
| ACI3ES_RS08320 | - | 1661776..1662822 (+) | 1047 | WP_114667497.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16177.95 Da Isoelectric Point: 5.2440
>NTDB_id=1077026 ACI3ES_RS08245 WP_114667516.1 1655019..1655465(-) (ssb) [Leuconostoc falkenbergense strain SAEED 24451]
MINRVVLIGRLTKDVEVRYTQSGVAVGTLSLAVNRPFTNASGEREADFINGVIWRKAAENFANFTHKGALVAIEGRLQTR
NYEDGNGKRVYVTEVVADNFSLLEKKSDGQQSAPKSQAPDPFANQGNQNKFAGSGNTEIDISDDDLPF
MINRVVLIGRLTKDVEVRYTQSGVAVGTLSLAVNRPFTNASGEREADFINGVIWRKAAENFANFTHKGALVAIEGRLQTR
NYEDGNGKRVYVTEVVADNFSLLEKKSDGQQSAPKSQAPDPFANQGNQNKFAGSGNTEIDISDDDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=1077026 ACI3ES_RS08245 WP_114667516.1 1655019..1655465(-) (ssb) [Leuconostoc falkenbergense strain SAEED 24451]
ATGATTAACAGAGTAGTGCTCATTGGTCGATTGACCAAAGATGTTGAAGTTAGATACACACAATCAGGTGTGGCAGTTGG
AACATTAAGTTTAGCGGTTAATCGTCCATTTACGAATGCTAGTGGCGAACGTGAAGCGGACTTTATCAACGGTGTTATCT
GGCGCAAAGCAGCCGAAAACTTCGCTAACTTCACACACAAAGGTGCGCTAGTGGCGATTGAGGGACGGTTGCAAACACGC
AACTACGAAGACGGAAACGGCAAGCGTGTTTATGTCACAGAGGTTGTAGCTGATAATTTCAGTTTGTTGGAAAAGAAGAG
TGATGGTCAGCAATCAGCACCGAAGTCACAGGCACCTGATCCATTCGCAAATCAAGGCAATCAAAATAAATTTGCTGGTA
GTGGCAACACTGAAATTGACATTTCAGATGACGATTTACCATTTTAG
ATGATTAACAGAGTAGTGCTCATTGGTCGATTGACCAAAGATGTTGAAGTTAGATACACACAATCAGGTGTGGCAGTTGG
AACATTAAGTTTAGCGGTTAATCGTCCATTTACGAATGCTAGTGGCGAACGTGAAGCGGACTTTATCAACGGTGTTATCT
GGCGCAAAGCAGCCGAAAACTTCGCTAACTTCACACACAAAGGTGCGCTAGTGGCGATTGAGGGACGGTTGCAAACACGC
AACTACGAAGACGGAAACGGCAAGCGTGTTTATGTCACAGAGGTTGTAGCTGATAATTTCAGTTTGTTGGAAAAGAAGAG
TGATGGTCAGCAATCAGCACCGAAGTCACAGGCACCTGATCCATTCGCAAATCAAGGCAATCAAAATAAATTTGCTGGTA
GTGGCAACACTGAAATTGACATTTCAGATGACGATTTACCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.895 |
100 |
0.669 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.757 |
100 |
0.628 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.667 |
81.081 |
0.419 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.865 |
100 |
0.399 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.486 |
100 |
0.365 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.486 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
30.508 |
100 |
0.365 |