Detailed information NTG1043883

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: ACEPXO_RS08310
• Genome accession: NZ_CP168323
• Coordinates: 1644915..1645244 (+)
• Length: 109 a.a.
• NCBI ID: WP_000793380.1
• Uniprot ID: A0A0E1EKJ1
• Organism: Streptococcus agalactiae strain SA2BKE
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1639915..1650244

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACEPXO_RS08295 (ACEPXO_08295)	-	1642472..1642837 (+)	366	WP_000285373.1	DUF1033 family protein	-
ACEPXO_RS08300 (ACEPXO_08300)	comYA	1643010..1643981 (+)	972	WP_000250805.1	competence type IV pilus ATPase ComGA	Machinery gene
ACEPXO_RS08305 (ACEPXO_08305)	comYB	1643875..1644918 (+)	1044	WP_223295889.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACEPXO_RS08310 (ACEPXO_08310)	comGC/cglC	1644915..1645244 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
ACEPXO_RS08315 (ACEPXO_08315)	comYD	1645219..1645632 (+)	414	WP_000244261.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACEPXO_RS08320 (ACEPXO_08320)	comGE	1645604..1645903 (+)	300	WP_000234804.1	competence type IV pilus minor pilin ComGE	-
ACEPXO_RS08325 (ACEPXO_08325)	comGF	1645857..1646318 (+)	462	WP_001874812.1	competence type IV pilus minor pilin ComGF	-
ACEPXO_RS08330 (ACEPXO_08330)	comGG	1646296..1646667 (+)	372	WP_000601104.1	competence type IV pilus minor pilin ComGG	-
ACEPXO_RS08335 (ACEPXO_08335)	comYH	1646782..1647756 (+)	975	WP_001008574.1	class I SAM-dependent methyltransferase	Machinery gene
ACEPXO_RS08340 (ACEPXO_08340)	-	1647788..1648981 (+)	1194	WP_000047534.1	acetate kinase	-
ACEPXO_RS08345 (ACEPXO_08345)	-	1649133..1649339 (+)	207	WP_000798241.1	helix-turn-helix transcriptional regulator	-
ACEPXO_RS08350 (ACEPXO_08350)	-	1649398..1649535 (+)	138	WP_001865900.1	hypothetical protein	-
ACEPXO_RS08355 (ACEPXO_08355)	-	1649576..1650031 (+)	456	WP_000905673.1	hypothetical protein	-

Sequence

Protein

• Length: 109 a.a.
• Molecular weight: 12129.27 Da
• Isoelectric Point: 10.0311

>NTDB_id=1043883 ACEPXO_RS08310 WP_000793380.1 1644915..1645244(+) (comGC/cglC) [Streptococcus agalactiae strain SA2BKE]
MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKESVTRTGNAAVVKVVESQAELFELQETGRKASLSTLK
SGGYITEKQEKAYLDYYKDSSNGSQKISS

Nucleotide

• Length: 330 bp

>NTDB_id=1043883 ACEPXO_RS08310 WP_000793380.1 1644915..1645244(+) (comGC/cglC) [Streptococcus agalactiae strain SA2BKE]
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAAATGTTAGTTGTTTTGATCAT
TATTTCGGTCTTGTTGTTATTGTTTGTACCCAATTTATCAAAACAAAAGGAAAGTGTCACAAGAACTGGAAATGCCGCTG
TTGTCAAGGTTGTAGAAAGTCAAGCCGAACTTTTTGAACTGCAAGAAACAGGTAGAAAAGCTAGTTTATCCACTCTAAAA
TCTGGAGGATATATTACTGAAAAGCAAGAAAAAGCCTATTTAGATTATTATAAAGACAGTTCCAATGGTTCTCAGAAAAT
TTCAAGTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

3D structure

• AlphaFold DB: A0A0E1EKJ1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis NCTC 12261	60.55	100	0.606
comGC/cglC	Streptococcus mitis SK321	59.633	100	0.596
comYC	Streptococcus gordonii str. Challis substr. CH1	61.165	94.495	0.578
comGC/cglC	Streptococcus pneumoniae TIGR4	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae R6	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae Rx1	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae D39	57.798	100	0.578
comYC	Streptococcus mutans UA159	55.238	96.33	0.532
comYC	Streptococcus mutans UA140	55.238	96.33	0.532
comGC	Lactococcus lactis subsp. cremoris KW2	63.043	84.404	0.532
comYC	Streptococcus suis isolate S10	65.854	75.229	0.495